Essential maintenance is planned to begin on Fri Jan 24 2025. The website may be temporarily unavailable. Please use our fallback: https://wwwdev.ebi.ac.uk/uniprot/front-end/fallback/ in case of any outage.

G3VES0 · G3VES0_SARHA

Function

function

5'->3' DNA exonuclease which digests single-stranded DNA (ssDNA). Regulates inflammatory cytokine responses via the degradation of nucleic acids, by reducing the concentration of ssDNA able to stimulate TLR9, a nucleotide-sensing receptor in collaboration with PLD4. May be important in myotube formation. Plays a role in lysosomal homeostasis. Involved in the regulation of endosomal protein sorting.

Catalytic activity

  • Exonucleolytic cleavage in the 5'- to 3'-direction to yield nucleoside 3'-phosphates.
    EC:3.1.16.1 (UniProtKB | ENZYME | Rhea)

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentearly endosome membrane
Cellular Componentendoplasmic reticulum membrane
Cellular ComponentGolgi membrane
Cellular Componentlate endosome membrane
Cellular Componentlysosomal lumen
Cellular Componentlysosomal membrane
Molecular Functionsingle-stranded DNA 5'-3' DNA exonuclease activity
Biological Processlipid catabolic process
Biological Processmyotube differentiation
Biological Processregulation of cytokine production involved in inflammatory response

Keywords

Enzyme and pathway databases

Names & Taxonomy

Protein names

  • Recommended name
    5'-3' exonuclease PLD3
  • EC number
  • Alternative names
    • Choline phosphatase 3
    • Phosphatidylcholine-hydrolyzing phospholipase D3
    • Phospholipase D3

Gene names

    • Name
      PLD3

Organism names

Accessions

  • Primary accession
    G3VES0

Proteomes

Subcellular Location

Early endosome membrane
; Single-pass type II membrane protein
Endoplasmic reticulum membrane
; Single-pass type II membrane protein
Late endosome membrane
; Single-pass type II membrane protein
Lysosome lumen

PTM/Processing

Features

Showing features for signal, chain.

Type
IDPosition(s)Description
Signal1-23
ChainPRO_502972889924-3955'-3' exonuclease PLD3

Interaction

Subunit

Interacts with APP.

Protein-protein interaction databases

Family & Domains

Features

Showing features for domain.

TypeIDPosition(s)Description
Domain154-181PLD phosphodiesterase
Domain355-381PLD phosphodiesterase

Sequence similarities

Belongs to the phospholipase D family.

Keywords

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    395
  • Mass (Da)
    43,434
  • Last updated
    2021-04-07 v2
  • MD5 Checksum
    CD28752C0F49E0E0927811174BEFBDBC
MTLMTMGLGALLTQLLLWPRLRPPPERTQSPPNAICDDPCQIVLVESIPEGLSFPKGPVHPSISQAWLGLMAGARHSLDIASFYWTLTNNDTQTQEPSAQQGEEVLRQLQSLAPRGVSVRVAVSKPRGPQPQADLQSLLNSGAQVRMVDMQKLTHGVLHTKFWVVDQAHIYIGSANMDWRSLTQVKELGVVVYNCSCLAQDLAKVFEAYWYLGQPDSSIPSPWPDNYTTTTWAPWAGLGPSLPSLGARPLGTPDFHLPLNYLPIGQRRGRAAGTLTHLPGPHPRFWPAIDDALRRAAFERGVRVRLLVSCWGHSEPALRPFLLSLAALQDNHTHYDVQVRLFVVPSNETQARIPYARVNHNKYMVTDRAAYVGTSNWSGNCGLSPGGGPGPGVVF

Keywords

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help