G3V4F5 · G3V4F5_HUMAN
- Proteinubiquitinyl hydrolase 1
- GeneATXN3
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids150 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
Catalytic activity
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | cysteine-type deubiquitinase activity | |
Biological Process | protein deubiquitination | |
Biological Process | proteolysis |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameubiquitinyl hydrolase 1
- EC number
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionG3V4F5
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 110 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-150 | Josephin | ||||
Sequence: MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQVILYLSLRVICQIAKLTNSCR |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length150
- Mass (Da)17,411
- Last updated2011-11-16 v1
- Checksum553684AEBB45CA23
Computationally mapped potential isoform sequences
There are 24 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
P54252 | ATX3_HUMAN | ATXN3 | 361 | ||
A0A2R8Y888 | A0A2R8Y888_HUMAN | ATXN3 | 87 | ||
A0A2R8Y3X7 | A0A2R8Y3X7_HUMAN | ATXN3 | 351 | ||
C9JQV6 | C9JQV6_HUMAN | ATXN3 | 291 | ||
D6R9I5 | D6R9I5_HUMAN | ATXN3 | 99 | ||
G3V4U9 | G3V4U9_HUMAN | ATXN3 | 278 | ||
G3V5H3 | G3V5H3_HUMAN | ATXN3 | 161 | ||
G3V3R7 | G3V3R7_HUMAN | ATXN3 | 329 | ||
G3V3S5 | G3V3S5_HUMAN | ATXN3 | 114 | ||
G3V3T0 | G3V3T0_HUMAN | ATXN3 | 95 | ||
G3V3T6 | G3V3T6_HUMAN | ATXN3 | 126 | ||
G3V4B1 | G3V4B1_HUMAN | ATXN3 | 110 | ||
G3V4F4 | G3V4F4_HUMAN | ATXN3 | 159 | ||
G3V526 | G3V526_HUMAN | ATXN3 | 200 | ||
G3V328 | G3V328_HUMAN | ATXN3 | 260 | ||
G3V390 | G3V390_HUMAN | ATXN3 | 110 | ||
G3V3A6 | G3V3A6_HUMAN | ATXN3 | 78 | ||
G3V2G1 | G3V2G1_HUMAN | ATXN3 | 223 | ||
G3V2G2 | G3V2G2_HUMAN | ATXN3 | 150 | ||
D3VVP3 | D3VVP3_HUMAN | ATXN3 | 79 | ||
A0A0A0MS38 | A0A0A0MS38_HUMAN | ATXN3 | 310 | ||
E9PJN5 | E9PJN5_HUMAN | ATXN3 | 205 | ||
S4R399 | S4R399_HUMAN | ATXN3 | 202 | ||
F5H211 | F5H211_HUMAN | ATXN3 | 370 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL049872 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL121773 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |