G3QFB0 · G3QFB0_GORGO
- ProteinHistocompatibility minor 13
- GeneHM13
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids426 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasmic side of endoplasmic reticulum membrane | |
Cellular Component | Derlin-1 retrotranslocation complex | |
Cellular Component | lumenal side of endoplasmic reticulum membrane | |
Cellular Component | rough endoplasmic reticulum | |
Molecular Function | aspartic endopeptidase activity, intramembrane cleaving | |
Molecular Function | protein homodimerization activity | |
Molecular Function | ubiquitin protein ligase binding | |
Biological Process | in utero embryonic development | |
Biological Process | membrane protein proteolysis | |
Biological Process | membrane protein proteolysis involved in retrograde protein transport, ER to cytosol | |
Biological Process | signal peptide processing |
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Gorilla
Accessions
- Primary accessionG3QFB0
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Multi-pass membrane protein
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 33-55 | Helical | ||||
Sequence: ALAYGSLLLMALLPIFFGALRSV | ||||||
Transmembrane | 75-93 | Helical | ||||
Sequence: AARFPIIASCTLLGLYLFF | ||||||
Transmembrane | 100-121 | Helical | ||||
Sequence: YINLLLSMYFFVLGILALSHTI | ||||||
Transmembrane | 199-224 | Helical | ||||
Sequence: LLHLNNVSTGCILLGGLFIYDVFWVF | ||||||
Transmembrane | 258-277 | Helical | ||||
Sequence: FAMLGLGDVVIPGIFIALLL | ||||||
Transmembrane | 289-312 | Helical | ||||
Sequence: TYFYTSFAAYIFGLGLTIFIMHIF | ||||||
Transmembrane | 318-336 | Helical | ||||
Sequence: ALLYLVPACIGFPVLVALA |
Keywords
- Cellular component
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-27 | Disordered | ||||
Sequence: MDSALSDPHNGSAEAGGPTNSTTRPPS | ||||||
Compositional bias | 13-27 | Polar residues | ||||
Sequence: AEAGGPTNSTTRPPS | ||||||
Region | 365-426 | Disordered | ||||
Sequence: VSGSPASLADSMQQKLAGPRRRRPQNPSAIYEESNPKDPAAVTESKEGTEASASKGLEKKEK |
Sequence similarities
Belongs to the peptidase A22B family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length426
- Mass (Da)46,825
- Last updated2018-02-28 v2
- Checksum269AD5CC99982845
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
G3S6U2 | G3S6U2_GORGO | HM13 | 377 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 13-27 | Polar residues | ||||
Sequence: AEAGGPTNSTTRPPS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CABD030116372 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CABD030116373 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CABD030116374 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CABD030116375 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CABD030116376 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CABD030116377 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CABD030116378 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CABD030116379 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |