G3CE70 · G3CE70_MOUSE
- Proteinvitamin-K-epoxide reductase (warfarin-sensitive)
- GeneVkorc1
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids161 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum membrane | |
Molecular Function | quinone binding | |
Molecular Function | vitamin-K-epoxide reductase (warfarin-sensitive) activity | |
Biological Process | vitamin K metabolic process |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namevitamin-K-epoxide reductase (warfarin-sensitive)
- EC number
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionG3CE70
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Multi-pass membrane protein
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 104-122 | Helical | ||||
Sequence: ILLVLSSLVSVAGSVYLAW | ||||||
Transmembrane | 128-150 | Helical | ||||
Sequence: LYDFCIVCITTYAINVGLMLLSF |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-31 | |||||
Sequence: MGTTWRSPGLVRLALCLAGLALSLYALHVKA | ||||||
Chain | PRO_5007659887 | 32-161 | vitamin-K-epoxide reductase (warfarin-sensitive) | |||
Sequence: ARARDENYRALCDVGTAISCSRVFSSRWGRGFGLVEHMLGADSVLNQSNSIFGCLFYTLQLLLGCLRGRWASILLVLSSLVSVAGSVYLAWILFFVLYDFCIVCITTYAINVGLMLLSFQKVPEHKTKKH |
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 5-153 | Vitamin K epoxide reductase | ||||
Sequence: WRSPGLVRLALCLAGLALSLYALHVKAARARDENYRALCDVGTAISCSRVFSSRWGRGFGLVEHMLGADSVLNQSNSIFGCLFYTLQLLLGCLRGRWASILLVLSSLVSVAGSVYLAWILFFVLYDFCIVCITTYAINVGLMLLSFQKV |
Sequence similarities
Belongs to the VKOR family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length161
- Mass (Da)17,768
- Last updated2011-11-16 v1
- Checksum044BEED047A57FD9
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
HM027479 EMBL· GenBank· DDBJ | ADN33371.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
GQ905712 EMBL· GenBank· DDBJ | ADN94695.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
GQ905713 EMBL· GenBank· DDBJ | ADN94696.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112384 EMBL· GenBank· DDBJ | QQO58431.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112390 EMBL· GenBank· DDBJ | QQO58437.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112391 EMBL· GenBank· DDBJ | QQO58438.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112400 EMBL· GenBank· DDBJ | QQO58447.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112409 EMBL· GenBank· DDBJ | QQO58456.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112413 EMBL· GenBank· DDBJ | QQO58460.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112418 EMBL· GenBank· DDBJ | QQO58465.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112419 EMBL· GenBank· DDBJ | QQO58466.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112426 EMBL· GenBank· DDBJ | QQO58473.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112444 EMBL· GenBank· DDBJ | QQO58491.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112450 EMBL· GenBank· DDBJ | QQO58497.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112472 EMBL· GenBank· DDBJ | QQO58519.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112473 EMBL· GenBank· DDBJ | QQO58520.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112503 EMBL· GenBank· DDBJ | QQO58550.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112504 EMBL· GenBank· DDBJ | QQO58551.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112515 EMBL· GenBank· DDBJ | QQO58562.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112525 EMBL· GenBank· DDBJ | QQO58572.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112580 EMBL· GenBank· DDBJ | QQO58627.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112581 EMBL· GenBank· DDBJ | QQO58628.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT112684 EMBL· GenBank· DDBJ | QQO58731.1 EMBL· GenBank· DDBJ | Genomic DNA |