G1TY34 · G1TY34_RABIT
- ProteinIntegrin subunit alpha 4
- GeneITGA4
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids1031 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 314 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 316 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 318 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 320 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 322 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 377 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 379 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 381 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 383 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 385 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 439 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 441 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 443 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 445 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 447 | Ca2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: D |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Lagomorpha > Leporidae > Oryctolagus
Accessions
- Primary accessionG1TY34
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Single-pass type I membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 976-1000 | Helical | ||||
Sequence: FTIVIISSSLLLGLIVLLLISYVMW |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-33 | |||||
Sequence: MAGEARRGSGSRGAAVREAVMLLLCLGIPTGRP | ||||||
Chain | PRO_5001424555 | 34-1031 | ||||
Sequence: YNLDTESALLYQGPPGTLFGYSVALHSHGSNRWLIVGAPTANWLANASVVSPGAIYRCRIGQNPGQTCEQLQLGSPTGEPCGKTCLEERDNEWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPIGVCYGMPSDLRTELSKRMAPCYQDYIRKFGENFASCQAGISSFYTEDLIVMGAPGSFYWTGSLFVYNITTNKYKAFWDKDNQVKFGSYLGYSVGAGHFWSRHTTEVVGGAPQHEQIGKAYIFSIDARELNILYEMKGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNEMETELIGSDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLRGAIYIYNGRADGISPTFSQRIEGLQVSKSLSMFGQSISGQIDADNNGYVDVAVGAFRSNSAVLLRTRPVVIVDASLRHPEAVNRTKFDCIENGLPSVCIDLKLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPSRFYFSSNGTSDVITGSIQVSSKATNCRTHQAFMRKDVRDILTPVQIEAAYRLGQHVLTKRSAEEFPPLQPILQQKKEKDVIKKMINFARFCAHENCTADLQVSAKIGFLKPHENKTYLAVGGMKMLMLNVSLFNAGDDAYGTTLHIRLPMGLYFIKILDLEEKQINCEVTESSGPVKLDCSVGYIYVDHLSRIDISFLLDVSSLSRAEEDVNITVHATCENEGEMDTLKHNKVTLAIPLRYEVMLTAHGFVNPTSFVYGSSEENDHETCMTEKMNLTFHVINTGNSMAPNVSMEIMVPNSFMPQTNKLFNILDVQMTTGECFFETYQRECALEQPKGAMETLKGIFTFLSKTDKRLLYCIKADPHCLNVLCNFGKMESGKEASVHIQLEGRPSILEMDETSSLKFEIRATAFPEPHPKVVELNKEENVAHVLLEGLHHQRPKRHFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRDSWSYVKSNNDN | ||||||
Glycosylation | 79 | N-acetyl-D-glucosamine 1 | ||||
Sequence: N | ||||||
Glycosylation | 79 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 91↔101 | |||||
Sequence: CRIGQNPGQTC | ||||||
Disulfide bond | 114↔118 | |||||
Sequence: CGKTC | ||||||
Glycosylation | 122 | N-acetyl-D-glucosamine 1 | ||||
Sequence: R | ||||||
Glycosylation | 137 | N-acetyl-D-glucosamine 2 | ||||
Sequence: E | ||||||
Glycosylation | 138 | N-acetyl-D-glucosamine 2 | ||||
Sequence: N | ||||||
Glycosylation | 138 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 144↔165 | |||||
Sequence: CGHRWKNIFYIKNENKLPIGVC | ||||||
Disulfide bond | 183↔198 | |||||
Sequence: CYQDYIRKFGENFASC | ||||||
Disulfide bond | 486↔495 | |||||
Sequence: CIENGLPSVC | ||||||
Disulfide bond | 501↔557 | |||||
Sequence: CFSYKGKEVPGYIVLFYNMSLDVNRKAESPSRFYFSSNGTSDVITGSIQVSSKATNC | ||||||
Glycosylation | 518 | N-acetyl-D-glucosamine 3 | ||||
Sequence: N | ||||||
Glycosylation | 518 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 538 | N-acetyl-D-glucosamine 4 | ||||
Sequence: N | ||||||
Glycosylation | 538 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 541 | N-acetyl-D-glucosamine 4 | ||||
Sequence: S | ||||||
Glycosylation | 545 | N-acetyl-D-glucosamine 4 | ||||
Sequence: T |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for repeat, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 35-100 | FG-GAP | ||||
Sequence: NLDTESALLYQGPPGTLFGYSVALHSHGSNRWLIVGAPTANWLANASVVSPGAIYRCRIGQNPGQT | ||||||
Repeat | 292-351 | FG-GAP | ||||
Sequence: NILYEMKGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVM | ||||||
Repeat | 355-412 | FG-GAP | ||||
Sequence: ETELIGSDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLRGAIYIYNGRADGISP | ||||||
Repeat | 416-478 | FG-GAP | ||||
Sequence: QRIEGLQVSKSLSMFGQSISGQIDADNNGYVDVAVGAFRSNSAVLLRTRPVVIVDASLRHPEA | ||||||
Domain | 463-620 | Integrin alpha first immunoglubulin-like | ||||
Sequence: TRPVVIVDASLRHPEAVNRTKFDCIENGLPSVCIDLKLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPSRFYFSSNGTSDVITGSIQVSSKATNCRTHQAFMRKDVRDILTPVQIEAAYRLGQHVLTKRSAEEFPPLQPILQQKKEKDVIKKMINFAR | ||||||
Domain | 622-769 | Integrin alpha second immunoglobulin-like | ||||
Sequence: CAHENCTADLQVSAKIGFLKPHENKTYLAVGGMKMLMLNVSLFNAGDDAYGTTLHIRLPMGLYFIKILDLEEKQINCEVTESSGPVKLDCSVGYIYVDHLSRIDISFLLDVSSLSRAEEDVNITVHATCENEGEMDTLKHNKVTLAIP | ||||||
Domain | 779-957 | Integrin alpha third immunoglobulin-like | ||||
Sequence: HGFVNPTSFVYGSSEENDHETCMTEKMNLTFHVINTGNSMAPNVSMEIMVPNSFMPQTNKLFNILDVQMTTGECFFETYQRECALEQPKGAMETLKGIFTFLSKTDKRLLYCIKADPHCLNVLCNFGKMESGKEASVHIQLEGRPSILEMDETSSLKFEIRATAFPEPHPKVVELNKEE |
Sequence similarities
Belongs to the integrin alpha chain family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,031
- Mass (Da)114,656
- Last updated2011-10-19 v1
- Checksum961852B4D3F20116
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A5F9DBS0 | A0A5F9DBS0_RABIT | ITGA4 | 1016 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AAGW02003809 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AAGW02003810 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AAGW02003811 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AAGW02003812 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |