G1TUK9 · G1TUK9_RABIT
- ProteinBardet-Biedl syndrome 4
- GeneBBS4
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids493 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | BBSome | |
Cellular Component | centriolar satellite | |
Cellular Component | centriole | |
Cellular Component | ciliary basal body | |
Cellular Component | ciliary membrane | |
Cellular Component | ciliary transition zone | |
Cellular Component | motile cilium | |
Cellular Component | non-motile cilium | |
Cellular Component | nucleus | |
Cellular Component | pericentriolar material | |
Molecular Function | alpha-tubulin binding | |
Molecular Function | beta-tubulin binding | |
Molecular Function | dynactin binding | |
Molecular Function | protein-macromolecule adaptor activity | |
Molecular Function | RNA polymerase II-specific DNA-binding transcription factor binding | |
Biological Process | centrosome cycle | |
Biological Process | cilium assembly | |
Biological Process | maintenance of protein location in nucleus | |
Biological Process | microtubule anchoring at centrosome | |
Biological Process | mitotic cytokinesis | |
Biological Process | protein localization to centrosome | |
Biological Process | protein localization to cilium | |
Biological Process | regulation of cytokinesis |
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Sarcopterygii > Dipnotetrapodomorpha > Tetrapoda (tetrapods) > Amniota (amniotes) > Mammalia (mammals) > Theria > Eutheria (placentals) > Boreoeutheria > Euarchontoglires > Glires (Rodents and rabbits) > Lagomorpha > Leporidae (rabbits and hares) > Oryctolagus
Accessions
- Primary accessionG1TUK9
Proteomes
Subcellular Location
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for repeat, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 142-175 | TPR | ||||
Sequence: DLTYMMLGKVHLLEGDLDQAIGVYRKAVEFSPEN | ||||||
Repeat | 176-209 | TPR | ||||
Sequence: TELLTTLGLLYLQLGIYQKAFEYLGNALTYDPTN | ||||||
Repeat | 278-311 | TPR | ||||
Sequence: WKILYNLGLVHLTMQQYASAFHFLSAAINFQPKM | ||||||
Repeat | 312-345 | TPR | ||||
Sequence: GELYMLLAVALTNLEDIENAKRAYAEAVRLDQCN | ||||||
Region | 414-493 | Disordered | ||||
Sequence: VKDPKSKHRSPSSSKPAGLQQPLGSNQALGQAMSSAAAYRTLPSGAGGAAPLPKPPSLPLEPEPAAEASPTEALEQRSEK | ||||||
Compositional bias | 424-451 | Polar residues | ||||
Sequence: PSSSKPAGLQQPLGSNQALGQAMSSAAA | ||||||
Compositional bias | 462-476 | Pro residues | ||||
Sequence: AAPLPKPPSLPLEPE |
Sequence similarities
Belongs to the BBS4 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length493
- Mass (Da)54,943
- Last updated2019-12-11 v2
- Checksum8A69ADE8D762D251
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A5F9CFR9 | A0A5F9CFR9_RABIT | BBS4 | 347 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 424-451 | Polar residues | ||||
Sequence: PSSSKPAGLQQPLGSNQALGQAMSSAAA | ||||||
Compositional bias | 462-476 | Pro residues | ||||
Sequence: AAPLPKPPSLPLEPE |
Keywords
- Technical term