F8VYL3 · F8VYL3_HUMAN
- ProteinDynamin 1 like
- GeneDNM1L
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids117 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | GTP binding | |
Molecular Function | GTPase activity |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionF8VYL3
Proteomes
Organism-specific databases
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 70 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 22-117 | Dynamin-type G | ||||
Sequence: IIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENDPATWKNSRHLSKGVEAEEWGKFLHTKNKEPARY | ||||||
Region | 72-94 | Disordered | ||||
Sequence: QEDKRKTTGEENDPATWKNSRHL |
Sequence similarities
Belongs to the TRAFAC class dynamin-like GTPase superfamily. Dynamin/Fzo/YdjA family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length117
- Mass (Da)13,011
- Last updated2011-09-21 v1
- ChecksumB45ED5BC85F5E824
Computationally mapped potential isoform sequences
There are 23 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
O00429 | DNM1L_HUMAN | DNM1L | 736 | ||
H0YHY4 | H0YHY4_HUMAN | DNM1L | 88 | ||
H0YI79 | H0YI79_HUMAN | DNM1L | 504 | ||
F8VZ52 | F8VZ52_HUMAN | DNM1L | 696 | ||
F8VUJ9 | F8VUJ9_HUMAN | DNM1L | 719 | ||
F8VR28 | F8VR28_HUMAN | DNM1L | 97 | ||
B4DPZ9 | B4DPZ9_HUMAN | DNM1L | 156 | ||
F8W1W3 | F8W1W3_HUMAN | DNM1L | 168 | ||
B4DDQ3 | B4DDQ3_HUMAN | DNM1L | 180 | ||
A0A8V8TRA9 | A0A8V8TRA9_HUMAN | DNM1L | 104 | ||
A0A8V8TQT5 | A0A8V8TQT5_HUMAN | DNM1L | 587 | ||
A0A8V8TQV1 | A0A8V8TQV1_HUMAN | DNM1L | 140 | ||
A0A994J6L3 | A0A994J6L3_HUMAN | DNM1L | 148 | ||
A0A994J6L8 | A0A994J6L8_HUMAN | DNM1L | 576 | ||
A0A994J691 | A0A994J691_HUMAN | DNM1L | 103 | ||
A0A994J696 | A0A994J696_HUMAN | DNM1L | 563 | ||
A0A994J6A0 | A0A994J6A0_HUMAN | DNM1L | 409 | ||
A0A994J3M8 | A0A994J3M8_HUMAN | DNM1L | 602 | ||
A0A994J402 | A0A994J402_HUMAN | DNM1L | 576 | ||
A0A994J409 | A0A994J409_HUMAN | DNM1L | 194 | ||
A0A994J3F1 | A0A994J3F1_HUMAN | DNM1L | 181 | ||
A0A994J3G1 | A0A994J3G1_HUMAN | DNM1L | 386 | ||
A0A994J3G5 | A0A994J3G5_HUMAN | DNM1L | 561 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC084824 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC087588 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |