F7GUW7 · F7GUW7_MACMU
- ProteinRPTOR independent companion of MTOR complex 2
- GeneRICTOR
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids1732 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | TORC2 complex | |
Molecular Function | molecular adaptor activity | |
Molecular Function | protein kinase binding | |
Molecular Function | protein serine/threonine kinase activator activity | |
Molecular Function | ribosome binding | |
Biological Process | actin cytoskeleton organization | |
Biological Process | embryo development ending in birth or egg hatching | |
Biological Process | positive regulation of actin filament polymerization | |
Biological Process | positive regulation of peptidyl-tyrosine phosphorylation | |
Biological Process | positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction | |
Biological Process | positive regulation of TOR signaling | |
Biological Process | regulation of establishment of cell polarity | |
Biological Process | regulation of gene expression | |
Biological Process | regulation of inflammatory response | |
Biological Process | regulation of peptidyl-serine phosphorylation | |
Biological Process | TORC2 signaling |
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Cercopithecidae > Cercopithecinae > Macaca
Accessions
- Primary accessionF7GUW7
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 57-439 | Rapamycin-insensitive companion of mTOR N-terminal | ||||
Sequence: LGHLNNFTKLLCDIGHSEEKLGFNYEDIIICLRLALLNEAKEVRAAGLRALRYLIQDSSILQKVLKLKVDYLIARCIDIQQSNEVERTQALRLVRKMITVNASLFPSSVTNSLIAVGNDGLQERDRMVRACIAIICELALQNPEVVALRGGLNTILKNVIDCQLSRINEALITTILHLLNHPKTRQYVRADVELERILAPYTDFHYRHSPDTAEGQLKEDREARFLASKMGIIATFRSWAGIINLCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVTEEFIEALLSVDPGRFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALILSAFIRNGLLEGLVEVITNSDDHISVRATILLGELLHMANTILP | ||||||
Domain | 523-742 | Rapamycin-insensitive companion of mTOR middle | ||||
Sequence: DTEEALLINLRDSQVLQHKENLEWNWNLIGTILKWPNVNLRNYKDEQLHRFVRRLLYFYKPSSKLYANLDLDFAKAKQLTVVGCQFTEFLLESEEDGQGYLEDLVKDIVQWLNASSGMKPERSLQNNGLLTTLSQHYFLFIGTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHLLKLTVSSLDYSRDGLARVILSKILTAATDACRLYATKHLRVLLRA | ||||||
Domain | 920-992 | Rapamycin-insensitive companion of mTOR | ||||
Sequence: IKKLKASLWALGNIGSSNWGLNLLQEENVIPDILKLAKQCEVLSIRGTCVYVLGLIAKTKQGCDILKCHNWDA | ||||||
Region | 1022-1041 | Disordered | ||||
Sequence: LSLNSESTSSRHNSESESVP | ||||||
Region | 1101-1134 | Disordered | ||||
Sequence: SLTLPNKKHRSSSDPKGGKLSSESKTSNRRIRTL | ||||||
Region | 1194-1240 | Disordered | ||||
Sequence: HRENTSRERLVVESSTSSHMKMRSQSFNTDTTTSGISSMSSSPSRET | ||||||
Compositional bias | 1203-1240 | Polar residues | ||||
Sequence: LVVESSTSSHMKMRSQSFNTDTTTSGISSMSSSPSRET |
Sequence similarities
Belongs to the RICTOR family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,732
- Mass (Da)194,910
- Last updated2019-12-11 v3
- Checksum6BFA0CDB2FBDC816
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A5F8ABY8 | A0A5F8ABY8_MACMU | RICTOR | 245 | ||
A0A5F7ZSN9 | A0A5F7ZSN9_MACMU | RICTOR | 1701 | ||
F7GUW5 | F7GUW5_MACMU | RICTOR | 1716 | ||
A0A5F7Z9A6 | A0A5F7Z9A6_MACMU | RICTOR | 1677 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1203-1240 | Polar residues | ||||
Sequence: LVVESSTSSHMKMRSQSFNTDTTTSGISSMSSSPSRET |
Keywords
- Technical term