F7B2J5 · F7B2J5_ORNAN

Function

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentcell-cell junction
Cellular Componentcytoplasm
Cellular Componentcytosol
Cellular Componentfemale germ cell nucleus
Cellular Componentmembrane
Cellular Componentnucleoplasm
Cellular Componentnucleus
Cellular ComponentTEAD-YAP complex
Molecular Functionchromatin binding
Molecular FunctionDNA-binding transcription factor binding
Molecular Functionproline-rich region binding
Molecular FunctionRNA polymerase II cis-regulatory region sequence-specific DNA binding
Molecular Functiontranscription coactivator activity
Molecular Functiontranscription corepressor activity
Biological Processbud elongation involved in lung branching
Biological Processcanonical Wnt signaling pathway
Biological Processcardiac muscle tissue regeneration
Biological Processcell morphogenesis
Biological Processcellular response to gamma radiation
Biological Processcellular response to retinoic acid
Biological ProcessDNA damage response
Biological Processembryonic heart tube morphogenesis
Biological Processenterocyte differentiation
Biological Processepithelial cell proliferation
Biological Processextrinsic apoptotic signaling pathway
Biological Processglandular epithelial cell differentiation
Biological Processheart process
Biological Processhippo signaling
Biological Processinterleukin-6-mediated signaling pathway
Biological Processintestinal epithelial cell development
Biological Processkeratinocyte differentiation
Biological Processlateral mesoderm development
Biological Processlung epithelial cell differentiation
Biological Processnegative regulation of cilium assembly
Biological Processnegative regulation of epithelial cell apoptotic process
Biological Processnegative regulation of epithelial cell differentiation
Biological Processnegative regulation of extrinsic apoptotic signaling pathway
Biological Processnegative regulation of fat cell differentiation
Biological Processnegative regulation of gene expression
Biological Processnegative regulation of stem cell differentiation
Biological Processnegative regulation of transcription by RNA polymerase II
Biological Processnotochord development
Biological Processorgan growth
Biological Processparaxial mesoderm development
Biological Processpositive regulation of canonical Wnt signaling pathway
Biological Processpositive regulation of cardiac muscle cell proliferation
Biological Processpositive regulation of cell growth
Biological Processpositive regulation of epithelial cell proliferation
Biological Processpositive regulation of gene expression
Biological Processpositive regulation of Notch signaling pathway
Biological Processpositive regulation of osteoblast differentiation
Biological Processpositive regulation of protein localization to nucleus
Biological Processpositive regulation of stem cell population maintenance
Biological Processpositive regulation of transcription by RNA polymerase II
Biological Processprotein-containing complex assembly
Biological Processregulation of keratinocyte proliferation
Biological Processregulation of metanephric nephron tubule epithelial cell differentiation
Biological Processregulation of neurogenesis
Biological Processregulation of stem cell proliferation
Biological Processresponse to progesterone
Biological Processsomatic stem cell population maintenance
Biological Processtissue homeostasis
Biological Processvasculogenesis
Biological Processwound healing

Keywords

Names & Taxonomy

Protein names

  • Submitted names
    • Yes associated protein 1

Gene names

    • Name
      YAP1

Organism names

Accessions

  • Primary accession
    F7B2J5

Proteomes

Subcellular Location

Keywords

Expression

Gene expression databases

Interaction

Protein-protein interaction databases

Family & Domains

Features

Showing features for compositional bias, region, domain.

TypeIDPosition(s)Description
Compositional bias1-21Pro residues
Region1-66Disordered
Region169-197Disordered
Domain207-240WW
Domain266-299WW
Region311-344Disordered
Compositional bias328-344Polar residues
Compositional bias391-449Polar residues
Region391-472Disordered

Sequence similarities

Belongs to the YAP1 family.

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    540
  • Mass (Da)
    56,430
  • Last updated
    2020-12-02 v3
  • Checksum
    4E8BE12AD57E1B36
MDPGQQPAPAGGQPPAPPGTPASAAAANAAAGTPEPAGPGGGGGPGGAGPGGGGGPGGAGPGGGGGPVAAPAPVAAAAAAAPPPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPHTVPMRLRKLPDSFFKPPDPKAHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPSGVLSGPGASPSAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNIMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLTPQSPQGGIMGGGSSNQQQQMRLQQLQMEKERLRLKHQELLRQALRNINPSTANSPKRQELALRSQLPTMEQDGGAQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDSISQSNMPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Computationally mapped potential isoform sequences

There are 2 potential isoforms mapped to this entry

View all
EntryEntry nameGene nameLength
A0A6I8P0S5A0A6I8P0S5_ORNANYAP1530
A0A6I8PMT2A0A6I8PMT2_ORNANYAP1502

Features

Showing features for compositional bias.

TypeIDPosition(s)Description
Compositional bias1-21Pro residues
Compositional bias328-344Polar residues
Compositional bias391-449Polar residues

Keywords

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp