F6V6I0 · UBP13_XENTR
- ProteinUbiquitin carboxyl-terminal hydrolase 13
- Geneusp13
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids846 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Deubiquitinase that mediates deubiquitination of target proteins and is involved in various processes such as autophagy and endoplasmic reticulum-associated degradation (ERAD).
Catalytic activity
Activity regulation
Specifically inhibited by spautin-1 (specific and potent autophagy inhibitor-1), a derivative of MBCQ that binds to usp13 and inhibits deubiquitinase activity.
Features
Showing features for binding site, active site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | cysteine-type deubiquitinase activity | |
Molecular Function | cysteine-type endopeptidase activity | |
Molecular Function | ubiquitin binding | |
Molecular Function | zinc ion binding | |
Biological Process | autophagy | |
Biological Process | cell population proliferation | |
Biological Process | protein K63-linked deubiquitination | |
Biological Process | protein stabilization | |
Biological Process | proteolysis | |
Biological Process | regulation of autophagy | |
Biological Process | regulation of DNA-templated transcription |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameUbiquitin carboxyl-terminal hydrolase 13
- EC number
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Pipoidea > Pipidae > Xenopodinae > Xenopus > Silurana
Accessions
- Primary accessionF6V6I0
Proteomes
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000418014 | 1-846 | Ubiquitin carboxyl-terminal hydrolase 13 | |||
Sequence: MAEDLGELLVPYMPTIRVPKSGDRVYKTECAFSYDSPESDGGLYVCMSTFLGFGREHVERHYRKTGQSVYMHLKRHIRLKATGASGGAFPKRINGRLFLDLENNTEMNTEDYEYEDEAKLVIFPDHFEIALPNIEELPALVTIACDAVLNSKSPYRKLDQESWEEELQVSKFANNLVQIDNGVKIPPSGWKCSKCDLQENLWLNLTDGSIMCGRWFCSGSGGNGHALEHHKQMGYPLAVRLGSITPDGADVYSFDEEEAVIDPHLAKHLAHFGIDMLQMQGSENGVLDNEVKPRVNEWEVIQETGLKLKPMFGSGYTGIKNLGNSSYLTTVMQVIFSIPEFQRAYVGNLTRIFDYAPLDPTQDFSTQMAKLGHGLLSGQFSKPPMKSELIEQVMKEEHKPQPKGINTRMFKALMSKGHTEFSSNRQQDAEEFFLHFINLVERNSIGAENPSDVFRFLVEERTQCCQSRKVRYTERVDYIMQLPVPMETATNKEELIAYDLKRREAESAKRPPPELVRAKIPFSACLQAFTEPENVPDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKLDVSIDMPDLLDINHLRATGLKSGEEELPDIAPPIIIPDDPNGRMAESLLSGSGSNVNSSFKGAQPLNLPFGKKEAKLLRYMERMVEKFGFKFSVRLSVEIDFAEPLIIPGCGTVTSTSSHGQNALLNQPPEEIVALICSMGFPRNHALQALRATNNNLERALDWMFSHPESEEGADNVSGCVDTENNPNGIITDSEQEGPRIKDGNGRYELFGIISHAGTSTMSGHYVCHIKKEGRWVIYNDHKVSASERPPKELGYIYFYHRISC |
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for zinc finger, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Zinc finger | 168-276 | UBP-type; degenerate | ||||
Sequence: QVSKFANNLVQIDNGVKIPPSGWKCSKCDLQENLWLNLTDGSIMCGRWFCSGSGGNGHALEHHKQMGYPLAVRLGSITPDGADVYSFDEEEAVIDPHLAKHLAHFGIDM | ||||||
Domain | 317-844 | USP | ||||
Sequence: TGIKNLGNSSYLTTVMQVIFSIPEFQRAYVGNLTRIFDYAPLDPTQDFSTQMAKLGHGLLSGQFSKPPMKSELIEQVMKEEHKPQPKGINTRMFKALMSKGHTEFSSNRQQDAEEFFLHFINLVERNSIGAENPSDVFRFLVEERTQCCQSRKVRYTERVDYIMQLPVPMETATNKEELIAYDLKRREAESAKRPPPELVRAKIPFSACLQAFTEPENVPDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKLDVSIDMPDLLDINHLRATGLKSGEEELPDIAPPIIIPDDPNGRMAESLLSGSGSNVNSSFKGAQPLNLPFGKKEAKLLRYMERMVEKFGFKFSVRLSVEIDFAEPLIIPGCGTVTSTSSHGQNALLNQPPEEIVALICSMGFPRNHALQALRATNNNLERALDWMFSHPESEEGADNVSGCVDTENNPNGIITDSEQEGPRIKDGNGRYELFGIISHAGTSTMSGHYVCHIKKEGRWVIYNDHKVSASERPPKELGYIYFYHRI | ||||||
Domain | 633-676 | UBA 1 | ||||
Sequence: GSNVNSSFKGAQPLNLPFGKKEAKLLRYMERMVEKFGFKFSVRL | ||||||
Domain | 708-748 | UBA 2 | ||||
Sequence: QPPEEIVALICSMGFPRNHALQALRATNNNLERALDWMFSH |
Domain
The UBP-type zinc finger has lost its ability to bind ubiquitin and usp13 is not activated by unanchored ubiquitin.
The UBA domains mediate binding to ubiquitin.
Sequence similarities
Belongs to the peptidase C19 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length846
- Mass (Da)95,089
- Last updated2012-06-13 v2
- Checksum139B256C047BE39A
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8J0QHL3 | A0A8J0QHL3_XENTR | usp13 | 846 | ||
A0A8J0QKT1 | A0A8J0QKT1_XENTR | usp13 | 844 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AAMC01001929 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AAMC01001930 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AAMC01001931 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AAMC01001932 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AAMC01001933 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AAMC01001934 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |