F6PWC8 · F6PWC8_HORSE
- ProteinProstaglandin reductase 1
- GenePTGR1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids312 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
Catalytic activity
- (5S,12S)-dihydroxy-(6E,10E,12E,14Z)-eicosatetraenoate + NADP+ = 12-oxo-(5S)-hydroxy-(6E,8E,10E,14Z)-eicosatetraenoate + NADPH + H+This reaction proceeds in the forward direction.
- 13,14-dihydro-15-oxo-PGF2alpha + NADP+ = 15-oxoprostaglandin F2alpha + NADPH + H+This reaction proceeds in the backward direction.
- 13,14-dihydro-15-oxo-prostaglandin E1 + NADP+ = 15-oxoprostaglandin E1 + NADPH + H+This reaction proceeds in the backward direction.
- 13,14-dihydro-15-oxo-prostaglandin F1alpha + NADP+ = 15-oxoprostaglandin F1alpha + NADPH + H+This reaction proceeds in the backward direction.
- 20-hydroxy-leukotriene B4 + NADP+ = 12-oxo-20-hydroxy-leukotriene B4 + NADPH + H+This reaction proceeds in the forward direction.
- 4-hydroxynonanal + NADP+ = (E)-4-hydroxynon-2-enal + NADPH + H+This reaction proceeds in the backward direction.
- 6-trans-leukotriene B4 + NADP+ = 12-oxo-(5S)-hydroxy-(6E,8E,10E,14Z)-eicosatetraenoate + NADPH + H+This reaction proceeds in the forward direction.
- nonan-2-one + NADP+ = (3E)-nonen-2-one + NADPH + H+This reaction proceeds in the backward direction.
- octanal + NADP+ = (2E)-octenal + NADPH + H+This reaction proceeds in the backward direction.
- pentan-2-one + NADP+ = (E)-pent-3-en-2-one + NADPH + H+This reaction proceeds in the backward direction.
- decanal + NADP+ = (2E)-decenal + NADPH + H+This reaction proceeds in the backward direction.
- dodecanal + NADP+ = (2E)-dodecenal + NADPH + H+This reaction proceeds in the backward direction.
- hexanal + NADP+ = (E)-hex-2-enal + NADPH + H+This reaction proceeds in the backward direction.
- leukotriene B4 + NADP+ = 12-oxo-leukotriene B4 + NADPH + H+This reaction proceeds in the forward direction.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | 15-oxoprostaglandin 13-oxidase [NAD(P)+] activity | |
Molecular Function | 2-alkenal reductase [NAD(P)+] activity | |
Biological Process | prostaglandin metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProstaglandin reductase 1
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Perissodactyla > Equidae > Equus
Accessions
- Primary accessionF6PWC8
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Expression
Gene expression databases
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 15-310 | Enoyl reductase (ER) | ||||
Sequence: GSPTNSNFELKTVELPPLKNGAATKLKEGDVMMGQQVARVVESQNSAFPTGTIVLAHSGWTMHSISDGKALEKLPTGWPDTLPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAAGSDEKVAYLKKIGFDVAFNYKKVESLEETLKKASPDGYDCYFDNVGGVFSNTVICQMKKFGRIAICGAISTYNRTGELPPGPPPENMIYQQLRMEGFIVTTWQGEVREKALKDLLKWVLEGKIQYHEHITEGFENMPAAFMGMLKGENLGKAIV |
Sequence similarities
Belongs to the NADP-dependent oxidoreductase L4BD family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length312
- Mass (Da)33,659
- Last updated2023-09-13 v3
- Checksum047944D30680B472
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A9L0S2F1 | A0A9L0S2F1_HORSE | PTGR1 | 329 | ||
A0A5F5PMB4 | A0A5F5PMB4_HORSE | PTGR1 | 301 |
Keywords
- Technical term