F6NHA0 · F6NHA0_DANRE
- ProteinMetavinculin
- Genevcla
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1066 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Actin filament (F-actin)-binding protein involved in cell-matrix adhesion and cell-cell adhesion. Regulates cell-surface E-cadherin expression and potentiates mechanosensing by the E-cadherin complex. May also play important roles in cell morphology and locomotion.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | adherens junction | |
Cellular Component | cell-cell contact zone | |
Cellular Component | cytoplasm | |
Cellular Component | cytoskeleton | |
Cellular Component | focal adhesion | |
Cellular Component | plasma membrane | |
Cellular Component | podosome | |
Molecular Function | actin filament binding | |
Molecular Function | alpha-catenin binding | |
Molecular Function | beta-catenin binding | |
Molecular Function | structural molecule activity | |
Biological Process | atrioventricular valve morphogenesis | |
Biological Process | cell adhesion | |
Biological Process | heart contraction | |
Biological Process | membrane repolarization during cardiac muscle cell action potential | |
Biological Process | sarcomere organization |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameMetavinculin
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionF6NHA0
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Peripheral membrane protein
Membrane ; Peripheral membrane protein
Keywords
- Cellular component
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for coiled coil, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 360-387 | |||||
Sequence: LDILVGKVENAARKLEALTNAKQAIAKR | ||||||
Coiled coil | 538-593 | |||||
Sequence: RQELLAKCEQVEQLMMQLADLAARGEGESPQARAVAAHLLEAIKDLKAKMQEAMTQ | ||||||
Region | 837-890 | Disordered | ||||
Sequence: PQELDFPPPPPDLDQLHVNDDQAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKA | ||||||
Compositional bias | 859-873 | Pro residues | ||||
Sequence: APPKPPLPEGEVPPP | ||||||
Compositional bias | 874-890 | Basic and acidic residues | ||||
Sequence: RPPPPEEKDEEFPEQKA |
Sequence similarities
Belongs to the vinculin/alpha-catenin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,066
- Mass (Da)116,730
- Last updated2018-06-20 v1
- Checksum3E3FF1BC49FE2ECE
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
B3DI32 | B3DI32_DANRE | vcla | 1131 | ||
A0A8M2B3M1 | A0A8M2B3M1_DANRE | vcla | 1130 | ||
A0A8M9QJN2 | A0A8M9QJN2_DANRE | vcla | 1067 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 859-873 | Pro residues | ||||
Sequence: APPKPPLPEGEVPPP | ||||||
Compositional bias | 874-890 | Basic and acidic residues | ||||
Sequence: RPPPPEEKDEEFPEQKA |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CR762430 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CR788251 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CT025777 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |