F6NGQ6 · F6NGQ6_DANRE
- ProteinDAB adaptor protein 2
- Genedab2
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids589 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | clathrin-coated pit | |
Cellular Component | cytoplasm | |
Cellular Component | intracellular membrane-bounded organelle | |
Molecular Function | cargo receptor activity | |
Molecular Function | clathrin adaptor activity | |
Biological Process | angiogenesis | |
Biological Process | cell differentiation | |
Biological Process | negative regulation of canonical Wnt signaling pathway | |
Biological Process | Notch signaling pathway | |
Biological Process | positive regulation of endocytosis | |
Biological Process | positive regulation of epithelial to mesenchymal transition | |
Biological Process | receptor-mediated endocytosis | |
Biological Process | regulation of BMP signaling pathway | |
Biological Process | vasculature development |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionF6NGQ6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-24 | Disordered | ||||
Sequence: MSQSPEAETVTVVPAEPASTTESA | ||||||
Domain | 59-193 | PID | ||||
Sequence: GDGVRYKAKLIGVDDVQDARGDKMCQDSMMKLKGMAIAARSQGKHKQRIWINISLTGIKIVDEKTGVIEHEHVVNKISFIARDVTDNRAFGYVCGAEGQHQFFAIKTAQQAEPLVIDLKDLFQLIFNMKKKEQEA | ||||||
Region | 252-275 | Disordered | ||||
Sequence: LFAPPAQNESQASNQNASIPADLF | ||||||
Compositional bias | 255-275 | Polar residues | ||||
Sequence: PPAQNESQASNQNASIPADLF | ||||||
Region | 297-367 | Disordered | ||||
Sequence: TAPVSWGQTPTMFPPQAGVQVTIPGPPRPFPQPSAFGGLSAPAWGQQGASPFGPPAGTQAWGQPGAAAPVG | ||||||
Region | 395-416 | Disordered | ||||
Sequence: GMQQGAVAPPRPPPRPPVKEEP | ||||||
Compositional bias | 401-415 | Pro residues | ||||
Sequence: VAPPRPPPRPPVKEE |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length589
- Mass (Da)61,985
- Last updated2018-06-20 v1
- ChecksumA35B871B777E06CA
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M1P9G4 | A0A8M1P9G4_DANRE | dab2 | 797 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 255-275 | Polar residues | ||||
Sequence: PPAQNESQASNQNASIPADLF | ||||||
Compositional bias | 401-415 | Pro residues | ||||
Sequence: VAPPRPPPRPPVKEE |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX510649 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |