F5HF47 · UL32_HHV8P
- ProteinPackaging protein UL32 homolog
- GeneORF68
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids467 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Plays a role in efficient localization of neo-synthesized capsids to nuclear replication compartments, thereby controlling cleavage and packaging of virus genomic DNA (PubMed:29875246).
Facilitates thereby the transfer of newly replicated viral genomes to the packaging motor (PubMed:33554858).
Facilitates thereby the transfer of newly replicated viral genomes to the packaging motor (PubMed:33554858).
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 52 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 55 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 130 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 136 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 191 | Zn2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 192 | Zn2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 296 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 299 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 366 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 373 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 415 | Zn2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 452 | Zn2+ 3 (UniProtKB | ChEBI) | ||||
Sequence: H |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell cytoplasm | |
Cellular Component | host cell nucleus | |
Cellular Component | viral envelope | |
Molecular Function | metal ion binding |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended namePackaging protein UL32 homolog
Gene names
Organism names
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Peploviricota > Herviviricetes > Herpesvirales > Orthoherpesviridae > Gammaherpesvirinae > Rhadinovirus > Rhadinovirus humangamma8 > Human herpesvirus 8
- Virus hosts
Accessions
- Primary accessionF5HF47
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes to viral replication compartments.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Deletion mutants maintain viral DNA replication and late gene expression but does not produce infectious virions. In addition, viral DNA is not cleaved after replication.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 52 | Strong loss of stability. | ||||
Sequence: C → A | ||||||
Mutagenesis | 373 | Strong loss of stability. | ||||
Sequence: C → A | ||||||
Mutagenesis | 415 | Strong loss of stability. | ||||
Sequence: C → A | ||||||
Mutagenesis | 452 | Strong loss of stability. | ||||
Sequence: H → A |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000423766 | 1-467 | Packaging protein UL32 homolog | |||
Sequence: MFVPWQLGTITRHRDELQKLLAASLLPEHPEESLGNPIMTQIHQSLQPSSPCRVCQLLFSLVRDSSTPMGFFEDYACLCFFCLYAPHCWTSTMAAAADLCEIMHLHFPEEEATYGLFGPGRLMGIDLQLHFFVQKCFKTTAAEKILGISNLQFLKSEFIRGMLTGTITCNFCFKTSWPRTDKEEATGPTPCCQITDTTTAPASGIPELARATFCGASRPTKPSLLPALIDIWSTSSELLDEPRPRLIASDMSELKSVVASHDPFFSPPLQADTSQGPCLMHPTLGLRYKNGTASVCLLCECLAAHPEAPKALQTLQCEVMGHIENNVKLVDRIAFVLDNPFAMPYVSDPLLRELIRGCTPQEIHKHLFCDPLCALNAKVVSEDVLFRLPREQEYKKLRASAAAGQLLDANTLFDCEVVQTLVFLFKGLQNARVGKTTSLDIIRELTAQLKRHRLDLAHPSQTSHLYA |
Interaction
Subunit
Forms a homopentameric ring.
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 52-136 | Zinc finger 1 | ||||
Sequence: CRVCQLLFSLVRDSSTPMGFFEDYACLCFFCLYAPHCWTSTMAAAADLCEIMHLHFPEEEATYGLFGPGRLMGIDLQLHFFVQKC | ||||||
Region | 191-452 | Zinc finger 3 | ||||
Sequence: CCQITDTTTAPASGIPELARATFCGASRPTKPSLLPALIDIWSTSSELLDEPRPRLIASDMSELKSVVASHDPFFSPPLQADTSQGPCLMHPTLGLRYKNGTASVCLLCECLAAHPEAPKALQTLQCEVMGHIENNVKLVDRIAFVLDNPFAMPYVSDPLLRELIRGCTPQEIHKHLFCDPLCALNAKVVSEDVLFRLPREQEYKKLRASAAAGQLLDANTLFDCEVVQTLVFLFKGLQNARVGKTTSLDIIRELTAQLKRH | ||||||
Region | 296-373 | Zinc finger 2 | ||||
Sequence: CLLCECLAAHPEAPKALQTLQCEVMGHIENNVKLVDRIAFVLDNPFAMPYVSDPLLRELIRGCTPQEIHKHLFCDPLC |
Sequence similarities
Belongs to the herpesviridae UL32 protein family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length467
- Mass (Da)51,911
- Last updated2011-06-28 v1
- Checksum3B3C423978D2A52C
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF148805 EMBL· GenBank· DDBJ | AAD46496.2 EMBL· GenBank· DDBJ | Genomic DNA |