F5GVQ8 · F5GVQ8_9STRA
- ProteinPhotosystem II CP43 reaction center protein
- GenepsbC
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids324 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
One of the components of the core complex of photosystem II (PSII). It binds chlorophyll and helps catalyze the primary light-induced photochemical processes of PSII. PSII is a light-driven water:plastoquinone oxidoreductase, using light energy to abstract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | photosystem II | |
Molecular Function | chlorophyll binding | |
Molecular Function | electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity | |
Molecular Function | metal ion binding | |
Biological Process | photosynthetic electron transport in photosystem II |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended namePhotosystem II CP43 reaction center protein
Gene names
Encoded on
- Chloroplast
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Sar > Stramenopiles > Ochrophyta > Bacillariophyta > Mediophyceae > Biddulphiophycidae > Ardissoneales > Ardissoneaceae > Ardissonea
Accessions
- Primary accessionF5GVQ8
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Plastid, chloroplast thylakoid membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 55-75 | Helical | ||||
Sequence: YFSVGVLHLISSAVLGFGGIY | ||||||
Transmembrane | 104-125 | Helical | ||||
Sequence: ILGIHLCLLGLGSFLLVIKAMY | ||||||
Transmembrane | 177-197 | Helical | ||||
Sequence: IIGGHVWVGVLCILGGLWHIF | ||||||
Transmembrane | 218-236 | Helical | ||||
Sequence: YSLAAISIMGFTASLYSWY |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-19 | |||||
Sequence: AGLMVFWAGAMVLFEVSHF | ||||||
Chain | PRO_5003322995 | 20-324 | Photosystem II CP43 reaction center protein | |||
Sequence: VPEKPLYEQGFILIQHLATLGYGIGPGGEITTTLPYFSVGVLHLISSAVLGFGGIYHSLLGPDTLEESFPFFGYDWRDKNKMTTILGIHLCLLGLGSFLLVIKAMYLGGVYDTWAPGGGDVRLITTPTLNPIVIFGYVFRSPFGGDGWVVAVNNMEDIIGGHVWVGVLCILGGLWHIFTKPFSWARRAFVWSGEAYLSYSLAAISIMGFTASLYSWYNNTAYPSELYGPTGPEASQAQAFTFLVRDQRLGANVSSAQGPTGLGKYLMRSPSGEIIFGGETMRFWDLRAPWVEPLRGPNGLDINKI |
Interaction
Subunit
PSII is composed of 1 copy each of membrane proteins PsbA, PsbB, PsbC, PsbD, PsbE, PsbF, PsbH, PsbI, PsbJ, PsbK, PsbL, PsbM, PsbT, PsbX, PsbY, PsbZ, Ycf12, at least 3 peripheral proteins of the oxygen-evolving complex and a large number of cofactors. It forms dimeric complexes.
Structure
Family & Domains
Sequence similarities
Belongs to the PsbB/PsbC family. PsbC subfamily.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Length324
- Mass (Da)35,415
- Last updated2011-06-28 v1
- ChecksumCA70B0EB39741A12
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: A | ||||||
Non-terminal residue | 324 | |||||
Sequence: I |