F4K7C5 · F4K7C5_ARATH
- ProteinMyosin 2
- GeneMYA2
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1565 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | myosin complex | |
Cellular Component | peroxisome | |
Molecular Function | actin binding | |
Molecular Function | ATP binding | |
Molecular Function | calmodulin binding | |
Molecular Function | cytoskeletal motor activity | |
Molecular Function | GTP-dependent protein binding | |
Molecular Function | small GTPase binding | |
Biological Process | actin filament organization | |
Biological Process | actin filament-based movement | |
Biological Process | Golgi localization | |
Biological Process | gynoecium development | |
Biological Process | leaf pavement cell development | |
Biological Process | mitochondrion localization | |
Biological Process | peroxisome localization | |
Biological Process | root hair elongation | |
Biological Process | trichome morphogenesis |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionF4K7C5
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Expression
Gene expression databases
Family & Domains
Features
Showing features for domain, region, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 68-117 | Myosin N-terminal SH3-like | ||||
Sequence: SVGSFVWVEDPDEAWIDGEVVQVNGDEIKVLCTSGKHVVTKISNAYPKDV | ||||||
Domain | 122-791 | Myosin motor | ||||
Sequence: SGVDDMTRLAYLHEPGVLQNLHSRYDINEIYTYTGSILIAVNPFRRLPHLYSSHMMAQYKGASLGELSPHPFAVADAAYRQMINDGVSQSILVSGESGAGKTESTKLLMRYLAYMGGRAAAEGRSVEQKVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDEKGRISGAAIRTYLLERSRVCQVSDPERNYHCFYMLCAAPQEDVKKFKLEEPKKYHYLNQSKCLELDSINDAEEYHATRRAMDVVGISTEEQDAIFSVVAAILHIGNIEFAKGEEIDSSIPKDDKSLFHLKTAAELLSCDEKALEDSLCKRIMVTRDETITKTLDPEAATLSRDALAKVMYSRLFDWLVDKINSSIGQDHDSKYLIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFNQHVFKMEQEEYKKEEINWSYIEFVDNQDILDLIEKKPGGIIALLDEACMFPRSTHETFAQKLYQTFKTHKRFTKPKLARSDFTICHYAGDVTYQTELFLDKNKDYVIAEHQALLNSSSCSFVASLFPPMSDDSKQSKFSSIGTRFKQQLVSLLEILNTTEPHYIRCIKPNNLLKPGIFENENILQQLRCGGVMEAIRISCAGYPTRKHFDEFLARFGILAPEVLVKNSDDPAACKKLLDKVGLEGYQIGKTKVFLRAGQMADLDTRRT | ||||||
Region | 672-694 | Actin-binding | ||||
Sequence: LVSLLEILNTTEPHYIRCIKPNN | ||||||
Coiled coil | 936-1107 | |||||
Sequence: LKMAARETGALQAAKNKLEKQVEELTWRLQLEKRIRTDLEEAKKQESAKAQSSLEELQLKCKETEALLIKEREAAKKIAETAPIIKEIPVVDQELMDKITNENEKLKSMVSSLEMKIGETEKKLQETTKISQDRLNQALEAESKLVKLKTAMQRLEEKILDMEAEKKIMHQQ | ||||||
Domain | 1208-1512 | Dilute | ||||
Sequence: DRLIQMIGSAIENEDDNSHLAYWLTSTSALLFLLQKSLKTNGSGATQSKKPPASTSLFGRMAMSFRSSPASGNLAAAAEAAALAVVRPVEAKYPALLFKQQLAAYVEKMFGMVRDNLKRELSTLLSLCIQAPRSSKGGMLRSGRSFGKDSPAVHWQSIIDGLNSLLVTLKENHVPLVLIQKIYSQTFSYINVQLFNSLLLRKECCTFSNGEFVKSGLAELELWCCQAKEYSGPSWEELKHIRQAVGFLVIHQKYRISYDEIANDLCPVLSVQQLYRICTLYWDDSYNTRSVSQEVISSMRTLMTE |
Sequence similarities
Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family. Plant myosin class XI subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,565
- Mass (Da)176,864
- Last updated2011-06-28 v1
- Checksum282B0EEE9CE5C704
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP002688 EMBL· GenBank· DDBJ | AED95023.1 EMBL· GenBank· DDBJ | Genomic DNA |