F4IV66 · RNE_ARATH
- ProteinRibonuclease E/G-like protein, chloroplastic
- GeneRNE
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1001 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in intercistronic processing of primary transcripts from chloroplast operons. The endonucleolytic activity of the enzyme depends on the number of phosphates at the 5' end, is inhibited by structured RNA, and preferentially cleaves A/U-rich sequences.
Cofactor
Protein has several cofactor binding sites:
Note: Binds 1 Mg2+ ion per subunit.
Note: Binds 2 Zn2+ ions per homotetramer. Zinc ions are bound between subunits.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 755 | Mg2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: D | ||||||
Binding site | 800 | Mg2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: D | ||||||
Binding site | 858 | Zn2+ (UniProtKB | ChEBI); ligand shared between dimeric partners | ||||
Sequence: C | ||||||
Binding site | 861 | Zn2+ (UniProtKB | ChEBI); ligand shared between dimeric partners | ||||
Sequence: C |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | chloroplast stroma | |
Molecular Function | metal ion binding | |
Molecular Function | RNA binding | |
Molecular Function | RNA endonuclease activity | |
Molecular Function | starch binding | |
Biological Process | chloroplast mRNA processing | |
Biological Process | chloroplast organization | |
Biological Process | chloroplast rRNA processing |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRibonuclease E/G-like protein, chloroplastic
- EC number
- Short namesRNase E/G-like protein
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionF4IV66
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Reduced photosynthetic activity and retarded growth. Increased number and decreased size of chloroplasts. Loss of autotrophic growth. Pale cotyledons when grown on sucrose-complemented medium.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 551 | Loss of endonucleolytic activity; when associated with A-557. | ||||
Sequence: K → A | ||||||
Mutagenesis | 557 | Loss of endonucleolytic activity; when associated with A-551. | ||||
Sequence: K → A | ||||||
Mutagenesis | 693-698 | In rne-2; loss of endonucleolytic activity. | ||||
Sequence: Missing |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 86 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-48 | Chloroplast | ||||
Sequence: MDVTEVPWRRLPQFSVSSRASWLVSSGFPLSSYMFSHVERGKTFRLTL | ||||||
Chain | PRO_0000421383 | 49-1001 | Ribonuclease E/G-like protein, chloroplastic | |||
Sequence: CFGVSRLRPRSAIPLRFLLSVFSEQPPSRLKGLCEVVWIVEADLAANEHLYVTGDPSTLGSWEPDCAISMYPTENDNEWEAKVKIASGVNFRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMSMSISSKSQESYGWGSWIDDAYLFPNCVTPAQSEDECTSADSAIEVPRTHLNDKQVGAESFLCDELAAFSSENSNLSALFSDNYQPIEEPWLIQESITLQHERNMQTDSEQDVESCDDNENNLNTDEQNHQLTETLLPDGGFFQSESIATTILINSSICTVQRIAVLEGGKLVELLLEPVKTNVQCDSVYLGVITKFVPHMGGAFVNIGSARHSFMDIKSNREPFIFPPFCDGSKKQAADGSPILSMNDIPAPHEIEHASYDFEASSLLDIDSNDPGESFHDDDDEHENDEYHVSDHLAGLVNGTVVNHGAVEVGSENGHIPMERGHSADSLDSNASVAKASKVMSSKDNKWIQVRKGTKIIVQVVKEGLGTKGPTLTAYPKLRSRFWVLLTRCKRIGVSKKISGVERTRLKVIAKTLQPQGFGLTVRTVAAGHSLEELQKDLDGLLLTWKNITDEAKSAALAADEGVEGAIPALLHRAMGQTLSVVQDYFNDKVEKMVVDSPRTYHEVTHYLQDMAPDLCNRVELHDKGIPLFDLYEIEEEIEGILSKRVPLSNGGSLVIEQTEALVSIDVNGGHGMFGQGNSQEKAILEVNLAAARQIAREIRLRDIGGIIVVDFIDMADESNKRLVYEEVKKAVERDRSLVKVSELSRHGLMEITRKRVRPSVTFMISEPCSCCHATGRVEALETTFSKIEQEICRQLAKMEKRGDLENPKSWPRFILRVDSHMSSFLTTGKRTRLAILSSSLKVWILLKVARHFTRGTFEVKPFMDEKTVNERQHQVAISLLKKADAIADSSGKKKLTLIPIKKEKTSGKQRR |
Proteomic databases
Expression
Tissue specificity
Expressed in cotyledons, rosette and cauline leaves.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 76-185 | CBM20 | ||||
Sequence: SRLKGLCEVVWIVEADLAANEHLYVTGDPSTLGSWEPDCAISMYPTENDNEWEAKVKIASGVNFRYNYLLKAGYGSSSDVIWRPGPQFSLSVPSSVNQDRKIIIRDSWMS | ||||||
Coiled coil | 769-789 | |||||
Sequence: QEKAILEVNLAAARQIAREIR |
Sequence similarities
Belongs to the RNase E/G family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 5 isoforms produced by Alternative splicing.
F4IV66-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length1,001
- Mass (Da)111,552
- Last updated2011-06-28 v1
- ChecksumEEC229D611EADB25
F4IV66-2
- Name2
- Differences from canonical
- 62-71: PLRFLLSVFS → VSAQQ
F4IV66-3
- Name3
F4IV66-4
- Name4
- Differences from canonical
- 1-288: Missing
F4IV66-5
- Name5
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q8GVF1 | Q8GVF1_ARATH | RNEE/G | 818 |
Sequence caution
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_045663 | 1-130 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_045662 | 1-288 | in isoform 4 and isoform 5 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_045664 | 62-71 | in isoform 2 | |||
Sequence: PLRFLLSVFS → VSAQQ | ||||||
Alternative sequence | VSP_045665 | 131-139 | in isoform 3 | |||
Sequence: VKIASGVNF → MIMNGKLKS | ||||||
Alternative sequence | VSP_045666 | 886-907 | in isoform 5 | |||
Sequence: AKMEKRGDLENPKSWPRFILRV → VSVIISILFCYFSFQPNEEHLE | ||||||
Alternative sequence | VSP_045667 | 908-1001 | in isoform 5 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF450479 EMBL· GenBank· DDBJ | AAN76770.1 EMBL· GenBank· DDBJ | mRNA | ||
AC007213 EMBL· GenBank· DDBJ | AAD27911.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002685 EMBL· GenBank· DDBJ | AEC05813.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC05814.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC05815.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC05816.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC05817.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | ANM63269.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | ANM63270.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | ANM63271.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY093213 EMBL· GenBank· DDBJ | AAM13212.1 EMBL· GenBank· DDBJ | mRNA | ||
BT008793 EMBL· GenBank· DDBJ | AAP68232.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ252122 EMBL· GenBank· DDBJ | CAB76425.1 EMBL· GenBank· DDBJ | mRNA |