F4I562 · AP3M_ARATH
- ProteinAP-3 complex subunit mu
- GeneAP3M
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids415 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Part of the AP-3 complex, an adaptor-related complex which seems to be clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to the vacuole. It also functions in maintaining the identity of lytic vacuoles and in regulating the transition between storage and lytic vacuoles.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | clathrin adaptor complex | |
Cellular Component | cytoplasmic vesicle membrane | |
Cellular Component | Golgi apparatus | |
Biological Process | gravitropism | |
Biological Process | intracellular protein transport | |
Biological Process | vesicle-mediated transport |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameAP-3 complex subunit mu
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionF4I562
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Cytoplasmic vesicle membrane ; Peripheral membrane protein
Note: Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Slightly reduced gravitropic response.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 398-415 | Affects vacuolar morphology; defective lytic vacuoles with altered morphology and accumulation of proteins. | ||||
Sequence: Missing |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 46 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000424263 | 1-415 | AP-3 complex subunit mu | |||
Sequence: MLQCIFLISDSGEVMLEKQLTGHRVDRSICAWFWDQYISQGDSFKALPVIASPTHYLFQIVRDGITFLACSQVEMPPLMAIEFLCRVADVLSEYLGGLNEDLIKDNFIIVYELLDEMIDNGFPLTTEPSILKEMIAPPNLVSKMLSVVTGNASNVSDTLPSGAGSCVPWRPTDPKYSSNEVYVDLVEEMDAIVNRDGELVKCEIYGEVQMNSQLTGFPDLTLSFANPSILEDMRFHPCVRYRPWESHQVLSFVPPDGEFKLMSYRVKKLKNTPVYVKPQITSDSGTCRISVLVGIRSDPGKTIESITLSFQLPHCVSSADLSSNHGTVTILSNKTCTWTIGRIPKDKTPCLSGTLALEPGLERLHVFPTFKLGFKIMGIALSGLRIEKLDLQTIPPRLYKGFRAQTRAGEFDVRL |
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
Adaptor protein complex 3 (AP-3) is a heterotetramer composed of two large adaptins (delta-type subunit and beta-type subunit), a medium adaptin (mu-type subunit) and a small adaptin (sigma-type subunit).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | F4I562 | TIFY8 Q84MB2 | 3 | EBI-25519891, EBI-4426557 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 178-414 | MHD | ||||
Sequence: SNEVYVDLVEEMDAIVNRDGELVKCEIYGEVQMNSQLTGFPDLTLSFANPSILEDMRFHPCVRYRPWESHQVLSFVPPDGEFKLMSYRVKKLKNTPVYVKPQITSDSGTCRISVLVGIRSDPGKTIESITLSFQLPHCVSSADLSSNHGTVTILSNKTCTWTIGRIPKDKTPCLSGTLALEPGLERLHVFPTFKLGFKIMGIALSGLRIEKLDLQTIPPRLYKGFRAQTRAGEFDVR |
Sequence similarities
Belongs to the adaptor complexes medium subunit family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length415
- Mass (Da)46,313
- Last updated2011-06-28 v1
- Checksum764A3AC60970D21A
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC009323 EMBL· GenBank· DDBJ | AAG09104.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002684 EMBL· GenBank· DDBJ | AEE33412.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX814222 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
BT015502 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |