F4HPZ9 · LIG6_ARATH
- ProteinDNA ligase 6
- GeneLIG6
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1396 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
DNA ligase that seals nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair (Probable). Required to maintain seed viability (e.g. longevity and storability) and during seed germination, probably by repairing DNA damage accumulated during seed development, storage and/or imbibition. Facilitates seed germination in cold conditions (2 degrees Celsius) and under oxidative stress (e.g. menadione, a genotoxic agent). Involved in repair of X-ray-induced damage (PubMed:20584150).
Limits stable root transformation by A.tumefaciens T-DNA.
Catalytic activity
Cofactor
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 1037 | ATP (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Active site | 1039 | N6-AMP-lysine intermediate | ||||
Sequence: K | ||||||
Binding site | 1044 | ATP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 1060 | ATP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 1092 | ATP (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 1092 | Mg2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 1136 | ATP (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 1207 | Mg2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 1212 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 1225 | ATP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 1231 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | ATP binding | |
Molecular Function | DNA binding | |
Molecular Function | DNA ligase (ATP) activity | |
Molecular Function | metal ion binding | |
Biological Process | DNA biosynthetic process | |
Biological Process | DNA integration | |
Biological Process | DNA recombination | |
Biological Process | DNA repair | |
Biological Process | DNA replication | |
Biological Process | double-strand break repair via nonhomologous end joining | |
Biological Process | positive regulation of cellular response to X-ray | |
Biological Process | response to bleomycin | |
Biological Process | response to cold | |
Biological Process | response to molecule of bacterial origin | |
Biological Process | response to oxidative stress | |
Biological Process | response to UV-C | |
Biological Process | seed development | |
Biological Process | seed germination |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA ligase 6
- EC number
- Short namesAtLIG6 ; DNA ligase VI
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionF4HPZ9
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Normal vegetative growth and fertility. Slightly enhanced sensitivity to X-rays, leading to a slight root growth reduction after 100-Gy dose of X-ray irradiation. Delayed germination of seeds, especially upon cold and oxidative stress (e.g. by menadione, a genotoxic agent), and reduced seed longevity and storability. Increased DNA damage response in germinating seeds, probably due to accumulation of DNA damage in seeds (PubMed:20584150).
Increased stable root transformation susceptibility by A.tumefaciens A208 T-DNA (PubMed:25641249).
Increased stable root transformation susceptibility by A.tumefaciens A208 T-DNA (PubMed:25641249).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 145 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000436440 | 1-1396 | DNA ligase 6 | |||
Sequence: MASDSAGATISGNFSNSDNSETLNLNTTKLYSSAISSISPQFPSPKPTSSCPSIPNSKRIPNTNFIVDLFRLPHQSSSVAFFLSHFHSDHYSGLSSSWSKGIIYCSHKTARLVAEILQVPSQFVFALPMNQMVKIDGSEVVLIEANHCPGAVQFLFKVKLESSGFEKYVHTGDFRFCDEMRFDPFLNGFVGCDGVFLDTTYCNPKFVFPSQEESVGYVVSVIDKISEEKVLFLVATYVVGKEKILVEIARRCKRKIVVDARKMSMLSVLGCGEEGMFTEDENESDVHVVGWNVLGETWPYFRPNFVKMNEIMVEKGYDKVVGFVPTGWTYEVKRNKFAVRFKDSMEIHLVPYSEHSNYDELREFIKFLKPKRVIPTVGVDIEKFDCKEVNKMQKHFSGLVDEMANKKDFLLGFYRQSYQKNEKSDVDVVSHSAEVYEEEEKNACEDGGENVPSSRGPILHDTTPSSDSRLLIKLRDSLPAWVTEEQMLDLIKKHAGNPVDIVSNFYEYEAELYKQASLPTPSLNNQAVLFDDDVTDLQPNPVKGICPDVQAIQKGFDLPRKMNLTKGTISPGKRGKSSGSKSNKKAKKDPKSKPVGPGQPTLFKFFNKVLDGGSNSVSVGSETEECNTDKKMVHIDASEAYKEVTDQFIDIVNGSESLRDYAASIIDEAKGDISRALNIYYSKPREIPGDHAGERGLSSKTIQYPKCSEACSSQEDKKASENSGHAVNICVQTSAEESVDKNYVSLPPEKYQPKEHACWREGQPAPYIHLVRTFASVESEKGKIKAMSMLCNMFRSLFALSPEDVLPAVYLCTNKIAADHENIELNIGGSLISSALEEACGISRSTVRDMYNSLGDLGDVAQLCRQTQKLLVPPPPLLVRDVFSTLRKISVQTGTGSTRLKKNLIVKLMRSCREKEIKFLVRTLARNLRIGAMLRTVLPALGRAIVMNSFWNDHNKELSESCFREKLEGVSAAVVEAYNILPSLDVVVPSLMDKDIEFSTSTLSMVPGIPIKPMLAKIAKGVQEFFNLSQEKAFTCEYKYDGQRAQIHKLLDGTVCIFSRNGDETTSRFPDLVDVIKQFSCPAAETFMLDAEVVATDRINGNKLMSFQELSTRERGSKDALITTESIKVEVCVFVFDIMFVNGEQLLALPLRERRRRLKEVFPETRPGYLEYAKEITVGAEEASLNNHDTLSRINAFLEEAFQSSCEGIMVKSLDVNAGYCPTKRSDSWLKVKRDYVDGLGDTLDLVPIGAWYGNGRKAGWYSPFLMACFNPETEEFQSVCRVMSGFSDAFYIEMKEFYSEDKILAKKPPYYRTGETPDMWFSAEVVWEIRGADFTVSPVHSASLGLVHPSRGISVRFPRFISKVTDRNPEECSTATDIAEMFHAQTRKMNITSQH |
Proteomic databases
PTM databases
Expression
Tissue specificity
Mostly expressed in buds and flowers, and, to a lower extent, in stems, leaves, siliques and seeds.
Induction
Induced by UV-C (PubMed:15155891).
Induced during seed imbibition (PubMed:20584150).
Induced slightly by bleomycin (BLM), a radiomimetic reagent that generates DNA double-strand breaks (DSBs) (PubMed:26074930).
Induced during seed imbibition (PubMed:20584150).
Induced slightly by bleomycin (BLM), a radiomimetic reagent that generates DNA double-strand breaks (DSBs) (PubMed:26074930).
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 441-464 | Disordered | ||||
Sequence: KNACEDGGENVPSSRGPILHDTTP | ||||||
Region | 562-599 | Disordered | ||||
Sequence: MNLTKGTISPGKRGKSSGSKSNKKAKKDPKSKPVGPGQ | ||||||
Motif | 572-579 | Nuclear localization signal 1 | ||||
Sequence: GKRGKSSG | ||||||
Motif | 886-893 | Nuclear localization signal 2 | ||||
Sequence: LRKISVQT |
Sequence similarities
Belongs to the ATP-dependent DNA ligase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,396
- Mass (Da)156,322
- Last updated2011-06-28 v1
- Checksum551005493C22FFC9
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC013288 EMBL· GenBank· DDBJ | AAG60081.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002684 EMBL· GenBank· DDBJ | AEE34549.1 EMBL· GenBank· DDBJ | Genomic DNA |