F3YAP5 · F3YAP5_MELPT
- ProteinDNA topoisomerase 1
- GenetopA
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids693 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Releases the supercoiling and torsional tension of DNA, which is introduced during the DNA replication and transcription, by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(5'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 3'-OH DNA strand. The free DNA strand then undergoes passage around the unbroken strand, thus removing DNA supercoils. Finally, in the religation step, the DNA 3'-OH attacks the covalent intermediate to expel the active-site tyrosine and restore the DNA phosphodiester backbone.
Catalytic activity
Features
Showing features for site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 34 | Interaction with DNA | ||||
Sequence: H | ||||||
Site | 140 | Interaction with DNA | ||||
Sequence: R | ||||||
Site | 141 | Interaction with DNA | ||||
Sequence: R | ||||||
Site | 144 | Interaction with DNA | ||||
Sequence: D | ||||||
Site | 149 | Interaction with DNA | ||||
Sequence: Y | ||||||
Site | 156 | Interaction with DNA | ||||
Sequence: W | ||||||
Active site | 300 | O-(5'-phospho-DNA)-tyrosine intermediate | ||||
Sequence: Y | ||||||
Site | 302 | Interaction with DNA | ||||
Sequence: R | ||||||
Site | 492 | Interaction with DNA | ||||
Sequence: R |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | chromosome | |
Molecular Function | DNA binding | |
Molecular Function | DNA topoisomerase type I (single strand cut, ATP-independent) activity | |
Molecular Function | metal ion binding | |
Biological Process | DNA topological change |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA topoisomerase 1
- EC number
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageBacteria > Bacillota > Bacilli > Lactobacillales > Enterococcaceae > Melissococcus
Accessions
- Primary accessionF3YAP5
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Interaction
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 4-114 | Toprim | ||||
Sequence: KYLVIVESPAKAKTIEKYLGRNYKVVASVGHIRDLPKSKMGIDIENDYAPHYISIRGKGDVIKSLKTAAKKADKVYLAADPDREGEAIAWHLSYLLGLDPNEKNRVVFNEI | ||||||
Region | 164-169 | Interaction with DNA | ||||
Sequence: SAGRVQ |
Sequence similarities
Belongs to the type IA topoisomerase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length693
- Mass (Da)79,229
- Last updated2011-06-28 v1
- ChecksumB7678B6B80AE047D
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP012200 EMBL· GenBank· DDBJ | BAK21573.1 EMBL· GenBank· DDBJ | Genomic DNA |