F2Z2R4 · F2Z2R4_HUMAN
- ProteinERCC excision repair 6 like 2
- GeneERCC6L2
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids207 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | ATP binding | |
Molecular Function | ATP-dependent chromatin remodeler activity | |
Molecular Function | helicase activity | |
Molecular Function | hydrolase activity |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionF2Z2R4
Proteomes
Organism-specific databases
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 215 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-23 | Disordered | ||||
Sequence: MDPSAPQPRAETSGKDIWHPGER | ||||||
Domain | 126-172 | SNF2 N-terminal | ||||
Sequence: YQREGTRFLYGHYIHGGGCILGDDMGLGKTVQVISFLAAVLHKKGTR |
Sequence similarities
Belongs to the SNF2/RAD54 helicase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length207
- Mass (Da)23,282
- Last updated2019-11-13 v2
- Checksum7782B33ED4E325A8
Computationally mapped potential isoform sequences
There are 16 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q5T890 | ER6L2_HUMAN | ERCC6L2 | 1550 | ||
A0AAQ5BIG0 | A0AAQ5BIG0_HUMAN | ERCC6L2 | 1561 | ||
H0Y3T7 | H0Y3T7_HUMAN | ERCC6L2 | 1058 | ||
A0A804HJ75 | A0A804HJ75_HUMAN | ERCC6L2 | 1186 | ||
A0A590UJV1 | A0A590UJV1_HUMAN | ERCC6L2 | 1169 | ||
A0A590UJK0 | A0A590UJK0_HUMAN | ERCC6L2 | 672 | ||
A0A590UJI9 | A0A590UJI9_HUMAN | ERCC6L2 | 49 | ||
A0A590UJA1 | A0A590UJA1_HUMAN | ERCC6L2 | 740 | ||
A0A590UJ12 | A0A590UJ12_HUMAN | ERCC6L2 | 700 | ||
X6RE28 | X6RE28_HUMAN | ERCC6L2 | 584 | ||
A0A804HK79 | A0A804HK79_HUMAN | ERCC6L2 | 1173 | ||
A0A804HJC4 | A0A804HJC4_HUMAN | ERCC6L2 | 1535 | ||
A0A804HL79 | A0A804HL79_HUMAN | ERCC6L2 | 663 | ||
A0AAA9Y8Y6 | A0AAA9Y8Y6_HUMAN | ERCC6L2 | 201 | ||
S4R327 | S4R327_HUMAN | ERCC6L2 | 257 | ||
A0A5F9UKL4 | A0A5F9UKL4_HUMAN | ERCC6L2 | 701 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL159167 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL161454 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL449403 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF458935 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |