F1QB54 · PABPA_DANRE
- ProteinPolyadenylate-binding protein 1A
- Genepabpc1a
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids634 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Binds the poly(A) tail of mRNA (By similarity).
Prevents mRNA deadenylation and confers poly(A) stability (By similarity).
Binds to N6-methyladenosine (m6A)-containing mRNAs (By similarity).
Stimulates the translation of mRNAs to which it is bound, acting, at least in part, with dazl (By similarity).
Involved in the maternal-to-zygotic transition in early embryo via interaction with ybx1: interaction recruits pabpc1a on C5-methylcytosine (m5C)-containing maternal mRNAs, preventing their degradation (PubMed:31399345).
Prevents mRNA deadenylation and confers poly(A) stability (By similarity).
Binds to N6-methyladenosine (m6A)-containing mRNAs (By similarity).
Stimulates the translation of mRNAs to which it is bound, acting, at least in part, with dazl (By similarity).
Involved in the maternal-to-zygotic transition in early embryo via interaction with ybx1: interaction recruits pabpc1a on C5-methylcytosine (m5C)-containing maternal mRNAs, preventing their degradation (PubMed:31399345).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasmic stress granule | |
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Cellular Component | ribonucleoprotein complex | |
Molecular Function | mRNA 3'-UTR binding | |
Molecular Function | poly(A) binding | |
Molecular Function | poly(U) RNA binding | |
Biological Process | heart development | |
Biological Process | mRNA processing | |
Biological Process | regulation of translation | |
Biological Process | translation |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePolyadenylate-binding protein 1A
- Short namesPABP-1A; Poly(A)-binding protein 1A
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionF1QB54
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000448384 | 1-634 | Polyadenylate-binding protein 1A | |||
Sequence: MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKEFTNVYIKNFGEDMDDEKLKEIFCKYGPALSIRVMTDDSGKSKGFGFVSFERHEDAQRAVDEMNGKEMNGKQVYVGRAQKKGERQTELKRKFEQMKQDRMTRYQGVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTSQYMQRMASVRAVPNPVLNPYQPAPPSGYFMAAIPQAQNRAAYYPTSQLAQLRPSPRWATQGVRPQHFQNMPNAAVRPSAPRPQTFNPVRPASQVPRMMTSQRMGSQAMGPRPAAAGAATGPAQVRGVPQYKYAPGVRNPQQHMPTQPQVPMQQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQNMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKSVPSPAVPAV |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 11-89 | RRM 1 | ||||
Sequence: ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQR | ||||||
Domain | 99-175 | RRM 2 | ||||
Sequence: GNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKS | ||||||
Domain | 191-268 | RRM 3 | ||||
Sequence: TNVYIKNFGEDMDDEKLKEIFCKYGPALSIRVMTDDSGKSKGFGFVSFERHEDAQRAVDEMNGKEMNGKQVYVGRAQK | ||||||
Domain | 294-370 | RRM 4 | ||||
Sequence: VNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQR | ||||||
Domain | 541-618 | PABC | ||||
Sequence: QEPLTASMLAAAPPQEQKQMLGERLFPLIQNMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQA |
Domain
RRM4, together with the C- and N-terminal regions, is sufficient for RNA-binding. RRM 1 has no RNA-binding activity itself, but improves discrimination between poly(A) and poly(U) in combination with the other repeats.
Sequence similarities
Belongs to the polyadenylate-binding protein type-1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length634
- Mass (Da)70,734
- Last updated2011-05-03 v1
- Checksum94F6AA6A33D747EF
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 522 | in Ref. 2; AAH99992 | ||||
Sequence: H → R |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CU855877 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC062832 EMBL· GenBank· DDBJ | AAH62832.1 EMBL· GenBank· DDBJ | mRNA | ||
BC099992 EMBL· GenBank· DDBJ | AAH99992.1 EMBL· GenBank· DDBJ | mRNA |