F1A411 · F1A411_DICPU

Function

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentplasma membrane
Cellular ComponentTORC2 complex
Cellular Componentvesicle
Molecular Functionadenylate cyclase activator activity
Molecular FunctionG protein activity
Molecular FunctionGDP binding
Molecular FunctionGTP binding
Molecular FunctionGTPase activity
Molecular Functionguanylate cyclase activator activity
Molecular Functionprotein kinase regulator activity
Molecular FunctionTORC2 complex binding
Biological Processactin cytoskeleton organization
Biological Processadenylate cyclase-modulating G protein-coupled receptor signaling pathway
Biological Processaggregation involved in sorocarp development
Biological Processasexual reproduction
Biological Processcell motility
Biological Processcellular response to cGMP
Biological Processchemotaxis to cAMP
Biological Processchemotaxis to folate
Biological Processestablishment or maintenance of cell polarity
Biological ProcessG protein-coupled chemorepellent receptor signaling pathway
Biological Processlateral pseudopodium retraction
Biological ProcessMAPK cascade
Biological Processnegative regulation of asexual reproduction
Biological Processphosphatidylinositol 3-kinase/protein kinase B signal transduction
Biological Processpolyphosphate-mediated signaling
Biological Processpositive regulation of cGMP-mediated signaling
Biological Processpositive regulation of filopodium assembly
Biological Processpositive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
Biological Processpositive regulation of positive chemotaxis to cAMP
Biological Processpositive regulation of TORC2 signaling
Biological Processprotein heterooligomerization
Biological ProcessRas protein signal transduction
Biological Processregulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
Biological Processregulation of cell growth
Biological Processresponse to electrical stimulus

Names & Taxonomy

Protein names

  • Recommended name
    Ras GTPase

Gene names

    • Name
      rasC
    • ORF names
      DICPUDRAFT_51488

Organism names

  • Taxonomic identifier
  • Strain
    • QSDP1
  • Taxonomic lineage
    Eukaryota > Amoebozoa > Evosea > Eumycetozoa > Dictyostelia > Dictyosteliales > Dictyosteliaceae > Dictyostelium

Accessions

  • Primary accession
    F1A411

Proteomes

Organism-specific databases

Subcellular Location

Interaction

Protein-protein interaction databases

Family & Domains

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    189
  • Mass (Da)
    21,469
  • Last updated
    2011-05-03 v1
  • Checksum
    6BA323B45F6EE4BA
MSKLLKLVIVGDGGVGKSALTIQLTQNQFIAEYDPTIENSYRKQVNIDDEVYMLDILDTAGQEEYSAMRDQYIRSGRGFLIVYSIISRPSFEAVSSFRDQILRVKDLSTYPIVIIGNKADLPDKDRKVPPMEGKELARSFGAPFLETSAKSRVNVEEAFFTLVREIKRWNQNPENEEMSPPKKRGCIIL

Keywords

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
GL871490
EMBL· GenBank· DDBJ
EGC29073.1
EMBL· GenBank· DDBJ
Genomic DNA

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp