E9Q7R9 · CFA43_MOUSE
- ProteinCilia- and flagella-associated protein 43
- GeneCfap43
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1682 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Flagellar protein involved in sperm flagellum axoneme organization and function (PubMed:28552195, PubMed:29449551, PubMed:31884020).
Involved in the regulation of the beating frequency of motile cilia on the epithelial cells of the respiratory tract (PubMed:31884020).
Involved in the regulation of the beating frequency of motile cilia on the epithelial cells of the respiratory tract (PubMed:31884020).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | 9+2 motile cilium | |
Cellular Component | axoneme | |
Cellular Component | extracellular region | |
Biological Process | brain development | |
Biological Process | cerebrospinal fluid circulation | |
Biological Process | cilium assembly | |
Biological Process | epithelial cilium movement involved in extracellular fluid movement | |
Biological Process | establishment of localization in cell | |
Biological Process | flagellated sperm motility | |
Biological Process | motile cilium assembly | |
Biological Process | mucociliary clearance | |
Biological Process | regulation of cilium beat frequency | |
Biological Process | sperm axoneme assembly |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameCilia- and flagella-associated protein 43
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionE9Q7R9
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Mice are viable and show no malformations. However, homozygous males exhibit complete male sterility due to severe defects in sperm mobility. Sperm from mutant mice exhibits teratozoospermia characterized by short, thick, and coiled flagella and sperm axonemal defects. Females are fertile and give litters of normal size (PubMed:28552195, PubMed:29449551, PubMed:31884020).
Mice display early onset hydrocephalus and severe mucus accumulation in the nasal cavity (PubMed:31884020).
Mice display early onset hydrocephalus and severe mucus accumulation in the nasal cavity (PubMed:31884020).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 89 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000445512 | 1-1682 | Cilia- and flagella-associated protein 43 | |||
Sequence: MSQDPERDDVTASATASASASAPASASAHYSGSSLSVRWVQGFPSQNVHFVNDQTICYPSGNFVIFINLETKKKTVLQCINGIVGVMATNVPSEVVAFSDRRFKPVIYIYSFPSLTRKNKLKGDILLDYTLLCFSYCGTYLASYSSLPEFELALWNWEASAILCKKSNPGMDVSQMSFNPMNWHQMCLSSSSAMSVWTIERSNQEHHFRIRSVKLPLEDATFLNEPDMLFPTTLPKDLIYGPVLPLSAIAGLVGEEAETFRPKDDIYPLLHPTMHCWTPSSDLYVGCEEGHLLMINTETLKVTVLQKAEEFPLPDGAPLINPLTLVYQKDGILASGIDGVIYSFIIKDSKYQVKTFLEFDGPVTHLVFSPSYKMLLIQTDKGSVYIYTFGAEMPLDKLLDACDGKVQAVSFITPGTKYFLTLTSSGEVSTVSLEDCNCTSRIFLKTQATALACSPSSPTAAVGTVDGYVYFLNILDVESPQMIHQAFLSQSPVKIVTYDQRGIFLLVGTEEGNIFVIDARPSKSFQIFGFTETGKDILQISTVSVMESDVVEVLVLYPLPDMGRSRLEYFTLPVMLPEVVPENFSDERGRLKDDLTHKYLYEVEHTLSSAVLGFTGSKIFGFCSQVPYICSYVMPVKEHTGVLVLKPHQKVQSKQYGSGTIYLSSHGLWLMTIAKCGILCIRDMFSMETFVRCRSHSHQGRGIQNMKMSLDGQHILVNGKDDNTLVCLKWKRLGANIASEIFEHSRPLVLHLSQTVESESVYLALSRESTNEQQEETTESQKHLNSDSSEEEAVIDHKMIPWIQQKMEEAIKKEVRIFSPRRKEIKRGIKELAQVIAMMMEENEKVDIIAKLDEQEFCLDADELERLHDECEEEVAKIRKDVEMHNLAQSYLTELIKEECWNSMAVKGRALKCFHIPYVVDNFPMKERTEEELQELSKVMQQKKTEIECLKLRKEIVEVQATTTIAKKHHEEEEEEEEDEERTIKTTSLPNYLLGSLSTDFGADTSLLTSQLDLHSREEKINQIILLKDIIYNIKRNFNSEFDAAYKQKEIEIARVKEKNVRIAEIISDLELEETVWQPVFEDSEKPERALVVEDDEISFKKYIAPWQRAKIKEVVSTYEMERLQQARISDERQRGLMDMMGGVLEVKKEDILRMVIPQPPFMAKADALWSEDERKQFKEYEKKVKELNEERDKYRKSLEAELKKLQNSIQESTQNFDDHLKRLFERRVKAEMVINQEELKINNIIFSLLLDEELSSREQFLNNYLLKKQEEKTKTAEAIQKAREDLDVFKEHHDMLVAEDKILDRSFKKEFSDILGHQVDVLYKLFKRRPRVHKQKTQADVTSLVPYGERPGSAKLNKENLAQLMKSMDELDNINNMPEGLDPSVWEHFCSTRRAKVENEYKVKQKAACLLEMTTFLRKRMEEDDVVHHEIEKVFHELIRLQDEKVRFQVNLTVQILLKQGQVELENFQLMLEYSDAILINKNIIEDLNSVIRTQGQKKVASMMESKEVHKGIYQIEWEHKKMEMEMEDLNQRAWDIEMLFFSRDRQKYLNEPNYENVIAIQIGIMEQTISVIDKTHKKNVENCKKLLKKLGKYSNQKDVANYTLSCNLREELVAVSERQDICNEIGSKLTCEKIARERYDNQLKQQKLLNISKQQAEQISILQAEVERLRMKTFPALIPM |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in testis (PubMed:28552195).
Expressed in the lung, brain, oviduct and nasal cavity (PubMed:31884020).
Expressed in the lung, brain, oviduct and nasal cavity (PubMed:31884020).
Developmental stage
During embryonic development, detected in the left-right organizer at 8.25 dpc and in 17.5 dpc embryos, detected in epithelial cells lining the respiratory tract, brain ependymal cells and the choroid plexus.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for repeat, region, compositional bias, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 168-207 | WD 1 | ||||
Sequence: NPGMDVSQMSFNPMNWHQMCLSSSSAMSVWTIERSNQEHH | ||||||
Repeat | 262-305 | WD 2 | ||||
Sequence: PKDDIYPLLHPTMHCWTPSSDLYVGCEEGHLLMINTETLKVTVL | ||||||
Repeat | 315-354 | WD 3 | ||||
Sequence: DGAPLINPLTLVYQKDGILASGIDGVIYSFIIKDSKYQVK | ||||||
Repeat | 358-397 | WD 4 | ||||
Sequence: EFDGPVTHLVFSPSYKMLLIQTDKGSVYIYTFGAEMPLDK | ||||||
Repeat | 488-527 | WD 5 | ||||
Sequence: LSQSPVKIVTYDQRGIFLLVGTEEGNIFVIDARPSKSFQI | ||||||
Repeat | 697-738 | WD 6 | ||||
Sequence: SHQGRGIQNMKMSLDGQHILVNGKDDNTLVCLKWKRLGANIA | ||||||
Region | 767-790 | Disordered | ||||
Sequence: RESTNEQQEETTESQKHLNSDSSE | ||||||
Compositional bias | 772-790 | Basic and acidic residues | ||||
Sequence: EQQEETTESQKHLNSDSSE | ||||||
Coiled coil | 926-960 | |||||
Sequence: KERTEEELQELSKVMQQKKTEIECLKLRKEIVEVQ | ||||||
Coiled coil | 1171-1223 | |||||
Sequence: SEDERKQFKEYEKKVKELNEERDKYRKSLEAELKKLQNSIQESTQNFDDHLKR |
Sequence similarities
Belongs to the CFAP43 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,682
- Mass (Da)193,426
- Last updated2011-04-05 v1
- Checksum14A6C6A6835E7CA7
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A494BB99 | A0A494BB99_MOUSE | Cfap43 | 562 | ||
A0A494BAF3 | A0A494BAF3_MOUSE | Cfap43 | 402 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 772-790 | Basic and acidic residues | ||||
Sequence: EQQEETTESQKHLNSDSSE |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC126679 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC131719 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |