E9PZZ1 · PRD13_MOUSE
- ProteinPR domain zinc finger protein 13
- GenePrdm13
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids754 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
May be involved in transcriptional regulation. Is required for the differentiation of Kiss1-expressing neurons in the arcuate (Arc) nucleus of the hypothalamus. Is a critical regulator of GABAergic cell fate in the cerebellum, required for normal postnatal cerebellar development (PubMed:34730112).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | chromatin binding | |
Molecular Function | DNA binding | |
Molecular Function | histone methyltransferase activity | |
Molecular Function | metal ion binding | |
Molecular Function | RNA polymerase II-specific DNA-binding transcription factor binding | |
Biological Process | GABAergic neuron differentiation | |
Biological Process | hypothalamus cell differentiation | |
Biological Process | methylation | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | neurogenesis | |
Biological Process | regulation of gene expression |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePR domain zinc finger protein 13
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionE9PZZ1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000416115 | 1-754 | PR domain zinc finger protein 13 | |||
Sequence: MPAHVTPRTEDARRGAGPSSACGCSWFCHLRPVEDPASPSVCLAAVATMHGTSRTSATSVNADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRMVRGELVDESGGSPLEWIGLIRAARNPQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFDIPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVLSGGGGRAFLPQEHAARPGASPVAEGLGLPPKPTVPDLTAPVQAIALRPQAPAAQLAQACGARESIKREASLAPLATSPPPGKWGTPKKGKEQPDRAHSQFLGIVGGSSGGGGGLPFYPGVRSAFKPAGLARAAAQSDPYREEGGGKGPGLALGRLLGGGRAGGRPGSGESPAGHHHHHHHAHHHHHHHPKCLLAGEPPPAGLPCPGALRAFPLLAGHPEEASAFKHVERAPPAAATTSLPSARYAALPAPGLPVERCALQPLDGGSLKAYPGGGGGGECSPLPAVMPAFTVYSGDLLYGPPAAYYPLKLHLGGLLKYPESISYLSGPAAAAAAAAAAAAAAAAIGPAELGSLASIDREIAMHTQQLSEMAAGKSRARLDSGTLPPAVVAATGPGGGGGGGSAAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQSLMAKAGDGPGPEPSYALEPGDPKSEDSDVDVCFTDDQSDPEAGGRGEHDS |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the brain, hypothalamus, and embryonic nose and brain tissues.
Developmental stage
Expression is observed in the cerebellum at 12.5-14.5 days post coitum (dpc). Transcripts are detected prominently in the ventricular zone of both the cerebellar vermis and hemispheres.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, zinc finger, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 39-160 | SET | ||||
Sequence: PSVCLAAVATMHGTSRTSATSVNADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRMVRGELVDESGGSPLEWIGLIRAARNPQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYS | ||||||
Zinc finger | 185-207 | C2H2-type 1 | ||||
Sequence: YICWYCWRTFRYPNSLKAHLRFH | ||||||
Region | 279-304 | Disordered | ||||
Sequence: ASLAPLATSPPPGKWGTPKKGKEQPD | ||||||
Region | 345-404 | Disordered | ||||
Sequence: QSDPYREEGGGKGPGLALGRLLGGGRAGGRPGSGESPAGHHHHHHHAHHHHHHHPKCLLA | ||||||
Compositional bias | 383-400 | Basic residues | ||||
Sequence: GHHHHHHHAHHHHHHHPK | ||||||
Zinc finger | 620-642 | C2H2-type 2 | ||||
Sequence: HLCLYCGKLYSRKYGLKIHMRTH | ||||||
Zinc finger | 648-670 | C2H2-type 3 | ||||
Sequence: LKCKVCLRPFGDPSNLNKHIRLH | ||||||
Zinc finger | 677-700 | C2H2-type 4 | ||||
Sequence: YRCEFCGKVLVRRRDLERHVKSRH | ||||||
Region | 694-754 | Disordered | ||||
Sequence: RHVKSRHPGQSLMAKAGDGPGPEPSYALEPGDPKSEDSDVDVCFTDDQSDPEAGGRGEHDS |
Sequence similarities
Belongs to the class V-like SAM-binding methyltransferase superfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
E9PZZ1-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length754
- Mass (Da)78,705
- Last updated2011-04-05 v1
- Checksum82E2B2E3B109C37B
E9PZZ1-2
- Name2
- Differences from canonical
- 1-48: Missing
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_042506 | 1-48 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 383-400 | Basic residues | ||||
Sequence: GHHHHHHHAHHHHHHHPK |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL672159 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |