E9PKH7 · E9PKH7_HUMAN
- ProteinEukaryotic translation elongation factor 1 delta
- GeneEEF1D
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids129 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Sarcopterygii > Dipnotetrapodomorpha > Tetrapoda (tetrapods) > Amniota (amniotes) > Mammalia (mammals) > Theria > Eutheria (placentals) > Boreoeutheria > Euarchontoglires > Primates > Haplorrhini > Simiiformes > Catarrhini > Hominoidea (apes) > Hominidae (great apes) > Homininae > Homo
Accessions
- Primary accessionE9PKH7
Proteomes
Organism-specific databases
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 308 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 94 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 25-99 | Disordered | ||||
Sequence: RRFYEHEATQAAASAQQLPAEGPAMNGPGQDDPEDADEAEAPDGGSRRDPRKSQDSRKPLQKKRKRSPKSGLGPA | ||||||
Compositional bias | 64-80 | Basic and acidic residues | ||||
Sequence: EAPDGGSRRDPRKSQDS |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length129
- Mass (Da)14,342
- Last updated2011-04-05 v1
- ChecksumFE3E5F8F616AF24B
Computationally mapped potential isoform sequences
There are 39 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
P29692 | EF1D_HUMAN | EEF1D | 281 | ||
H0YE58 | H0YE58_HUMAN | EEF1D | 119 | ||
H0YCK7 | H0YCK7_HUMAN | EEF1D | 210 | ||
A0A0J9YXU2 | A0A0J9YXU2_HUMAN | EEF1D | 109 | ||
A0A8C8L741 | A0A8C8L741_HUMAN | EEF1D | 363 | ||
E9PRL0 | E9PRL0_HUMAN | EEF1D | 257 | ||
E9PRY8 | E9PRY8_HUMAN | EEF1D | 697 | ||
E9PPY1 | E9PPY1_HUMAN | EEF1D | 157 | ||
E9PPR1 | E9PPR1_HUMAN | EEF1D | 166 | ||
E9PQ49 | E9PQ49_HUMAN | EEF1D | 198 | ||
E9PQC9 | E9PQC9_HUMAN | EEF1D | 36 | ||
E9PQZ1 | E9PQZ1_HUMAN | EEF1D | 238 | ||
E9PQR8 | E9PQR8_HUMAN | EEF1D | 300 | ||
E9PNC8 | E9PNC8_HUMAN | EEF1D | 146 | ||
E9PMW7 | E9PMW7_HUMAN | EEF1D | 130 | ||
E9PN91 | E9PN91_HUMAN | EEF1D | 106 | ||
E9PNW6 | E9PNW6_HUMAN | EEF1D | 35 | ||
E9PLA1 | E9PLA1_HUMAN | EEF1D | 84 | ||
E9PL71 | E9PL71_HUMAN | EEF1D | 187 | ||
E9PLS6 | E9PLS6_HUMAN | EEF1D | 62 | ||
E9PLT8 | E9PLT8_HUMAN | EEF1D | 81 | ||
E9PLL8 | E9PLL8_HUMAN | EEF1D | 21 | ||
E9PM66 | E9PM66_HUMAN | EEF1D | 68 | ||
E9PN56 | E9PN56_HUMAN | EEF1D | 180 | ||
E9PN71 | E9PN71_HUMAN | EEF1D | 190 | ||
E9PIZ1 | E9PIZ1_HUMAN | EEF1D | 137 | ||
E9PJ84 | E9PJ84_HUMAN | EEF1D | 36 | ||
E9PIP5 | E9PIP5_HUMAN | EEF1D | 49 | ||
E9PK01 | E9PK01_HUMAN | EEF1D | 261 | ||
E9PK06 | E9PK06_HUMAN | EEF1D | 139 | ||
E9PJD0 | E9PJD0_HUMAN | EEF1D | 99 | ||
E9PJV8 | E9PJV8_HUMAN | EEF1D | 179 | ||
E9PK72 | E9PK72_HUMAN | EEF1D | 63 | ||
E9PKK3 | E9PKK3_HUMAN | EEF1D | 39 | ||
E9PL12 | E9PL12_HUMAN | EEF1D | 168 | ||
E9PL21 | E9PL21_HUMAN | EEF1D | 31 | ||
E9PI93 | E9PI93_HUMAN | EEF1D | 53 | ||
E9PI39 | E9PI39_HUMAN | EEF1D | 204 | ||
A0A087X1X7 | A0A087X1X7_HUMAN | EEF1D | 631 |
Features
Showing features for compositional bias, non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 64-80 | Basic and acidic residues | ||||
Sequence: EAPDGGSRRDPRKSQDS | ||||||
Non-terminal residue | 129 | |||||
Sequence: L |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC067930 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |