E9NX73 · 2SS_FAGTA
- Protein2S seed storage albumin protein
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids149 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Seed storage protein.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | IgE binding | |
Molecular Function | nutrient reservoir activity |
Keywords
- Molecular function
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended name2S seed storage albumin protein
- Alternative names
- Allergen nameFag t 2.0101
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > Caryophyllales > Polygonaceae > Polygonoideae > Fagopyreae > Fagopyrum
Accessions
- Primary accessionE9NX73
Phenotypes & Variants
Allergenic properties
Causes an allergic reaction in human. Binds to IgE of patients allergic to buckwheat (PubMed:21645012, PubMed:29306152, PubMed:33412487).
Binds to IgE in 74% of the 23 tartarian buckwheat-allergic patients tested (PubMed:29306152).
IgE-binding of the natural and recombinant protein is unaffected by heat treatment or pepsin digestion (PubMed:21645012, PubMed:29306152).
Binds to IgE in 74% of the 23 tartarian buckwheat-allergic patients tested (PubMed:29306152).
IgE-binding of the natural and recombinant protein is unaffected by heat treatment or pepsin digestion (PubMed:21645012, PubMed:29306152).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 38 | No effect in a competitive IgE inhibition ELISA. | ||||
Sequence: C → G | ||||||
Mutagenesis | 52 | 21% inhibitory efficiency in a competitive IgE inhibition ELISA. | ||||
Sequence: C → G | ||||||
Mutagenesis | 71 | No effect in a competitive IgE inhibition ELISA. | ||||
Sequence: R → N | ||||||
Mutagenesis | 87-88 | 33% inhibitory efficiency in a competitive IgE inhibition ELISA. | ||||
Sequence: CC → GG | ||||||
Mutagenesis | 100 | 43% inhibitory efficiency in a competitive IgE inhibition ELISA. | ||||
Sequence: C → Y | ||||||
Mutagenesis | 132 | 55% inhibitory efficiency in a competitive IgE inhibition ELISA. | ||||
Sequence: K → N |
Keywords
- Disease
Protein family/group databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MKLFIILATATLLIAATQAKYL | ||||||
Chain | PRO_5003243888 | 23-149 | 2S seed storage albumin protein | |||
Sequence: RDEGFDLGETQMSSKCTRQVKMMEPELVKCNRYIAMDIMDDKYEEALSRIQGEGCESEEKFLRGCCVAMKEMEDECVCEWMKMMVENQKGRIGETLMRKGIRDLKELPNKCGISEMECHSRGNWYYV | ||||||
Disulfide bond | 38↔98 | |||||
Sequence: CTRQVKMMEPELVKCNRYIAMDIMDDKYEEALSRIQGEGCESEEKFLRGCCVAMKEMEDEC | ||||||
Disulfide bond | 52↔87 | |||||
Sequence: CNRYIAMDIMDDKYEEALSRIQGEGCESEEKFLRGC | ||||||
Disulfide bond | 88↔133 | |||||
Sequence: CVAMKEMEDECVCEWMKMMVENQKGRIGETLMRKGIRDLKELPNKC | ||||||
Disulfide bond | 100↔140 | |||||
Sequence: CEWMKMMVENQKGRIGETLMRKGIRDLKELPNKCGISEMEC |
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 41-53 | No IgE-binding | ||||
Sequence: QVKMMEPELVKCN | ||||||
Region | 68-81 | No IgE-binding | ||||
Sequence: ALSRIQGEGCESEE | ||||||
Region | 84-95 | No IgE-binding | ||||
Sequence: LRGCCVAMKEME | ||||||
Region | 97-105 | No IgE-binding | ||||
Sequence: ECVCEWMKM | ||||||
Region | 108-117 | IgE-binding | ||||
Sequence: ENQKGRIGET | ||||||
Region | 121-131 | No IgE-binding | ||||
Sequence: KGIRDLKELPN | ||||||
Region | 132-141 | IgE-binding | ||||
Sequence: KCGISEMECH |
Sequence similarities
Belongs to the 2S seed storage albumins family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length149
- Mass (Da)17,280
- Last updated2011-04-05 v1
- ChecksumAAC1B76E740AA260
Keywords
- Technical term