E6MV22 · FHBP_NEIMH
- ProteinFactor H binding protein
- GenefhbP
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids274 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
A bacterial surface lipoprotein that binds host (human) complement factor H (fH, gene CFH) (PubMed:16785547).
Binding contributes to the avoidance of complement-mediated lysis by N.meningitidis (Probable)
Binding contributes to the avoidance of complement-mediated lysis by N.meningitidis (Probable)
Miscellaneous
One of the major antigens of group B N.meningitidis and a powerful protective antigen. It is highly variable, at least 300 protein variants have been seen (see Factor H binding protein sequence typing below).
Biotechnology
Part of an outer membrane vesicle vaccine; antisera against this protein induce efficient complement-mediated killing of the homologous strain. Three antigenic variant groups were detected upon sequencing of group B strains; antibodies against a single variant group provide reduced protection against the other 2 groups. Recombinant protein lipidation increases its immunogenicity.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell outer membrane |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameFactor H binding protein
- Short namesfHbp
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Betaproteobacteria > Neisseriales > Neisseriaceae > Neisseria
Accessions
- Primary accessionE6MV22
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell outer membrane ; Lipid-anchor
Note: Surface exposed.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Bacteria no longer bind fH and are more sensitive to complement-mediated killing.
PTM/Processing
Features
Showing features for signal, lipidation, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-19 | |||||
Sequence: MNRTAFCCLSLTTALILTA | ||||||
Lipidation | 20 | N-palmitoyl cysteine | ||||
Sequence: C | ||||||
Lipidation | 20 | S-diacylglycerol cysteine | ||||
Sequence: C | ||||||
Chain | PRO_0000455081 | 20-274 | Factor H binding protein | |||
Sequence: CSSGGGGVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ |
Keywords
- PTM
Expression
Induction
Expressed at high levels in this strain (at protein level).
Interaction
Subunit
Binds to host factor H (fH from human) (PubMed:16785547).
Both fHbp beta-barrels contact Sushi domains 6 and 7 in fH (also called complement control protein domains, CCP). This interaction probably mimics the normal (carbohydrate-dependent) mode of fH recruitement, regulating fH activity (By similarity).
Both fHbp beta-barrels contact Sushi domains 6 and 7 in fH (also called complement control protein domains, CCP). This interaction probably mimics the normal (carbohydrate-dependent) mode of fH recruitement, regulating fH activity (By similarity).
Structure
Family & Domains
Domain
Structures show there are 2 beta barrel domains, 51-156 and 167-274 each form an 8-stranded antiparallel beta-barrel joined by linker between 157-166.
Sequence similarities
Belongs to the factor H binding-protein family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length274
- Mass (Da)28,990
- Last updated2022-02-23 v2
- Checksum5DDCF683CF877E2A
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AEQZ01000011 EMBL· GenBank· DDBJ | EFV64429.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
AY330397 EMBL· GenBank· DDBJ | AAR84472.1 EMBL· GenBank· DDBJ | Genomic DNA |