E5RH42 · E5RH42_HUMAN
- ProteinG3BP stress granule assembly factor 1
- GeneG3BP1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids117 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionE5RH42
Proteomes
Organism-specific databases
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 101 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 7 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 47 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 56 | PRIDE | Phosphotyrosine | ||||
Sequence: Y |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 11-117 | NTF2 | ||||
Sequence: VGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPE |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length117
- Mass (Da)13,289
- Last updated2011-02-08 v1
- Checksum1533DB852916981F
Computationally mapped potential isoform sequences
There are 34 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q13283 | G3BP1_HUMAN | G3BP1 | 466 | ||
A0A7P0P2U7 | A0A7P0P2U7_HUMAN | G3BP1 | 367 | ||
A0A7I2YQC2 | A0A7I2YQC2_HUMAN | G3BP1 | 17 | ||
A0A7I2YQF2 | A0A7I2YQF2_HUMAN | G3BP1 | 85 | ||
A0A7I2YQB1 | A0A7I2YQB1_HUMAN | G3BP1 | 61 | ||
A0A7I2YQM1 | A0A7I2YQM1_HUMAN | G3BP1 | 102 | ||
A0A7I2YQN9 | A0A7I2YQN9_HUMAN | G3BP1 | 426 | ||
A0A7I2YQH0 | A0A7I2YQH0_HUMAN | G3BP1 | 134 | ||
A0A7I2YQU8 | A0A7I2YQU8_HUMAN | G3BP1 | 334 | ||
A0A7I2YQP3 | A0A7I2YQP3_HUMAN | G3BP1 | 36 | ||
A0A7I2YQQ8 | A0A7I2YQQ8_HUMAN | G3BP1 | 63 | ||
A0A7I2YQR4 | A0A7I2YQR4_HUMAN | G3BP1 | 68 | ||
A0A7I2V274 | A0A7I2V274_HUMAN | G3BP1 | 40 | ||
E5RIF8 | E5RIF8_HUMAN | G3BP1 | 106 | ||
E5RJU8 | E5RJU8_HUMAN | G3BP1 | 153 | ||
E5RH00 | E5RH00_HUMAN | G3BP1 | 37 | ||
E5RI46 | E5RI46_HUMAN | G3BP1 | 31 | ||
A0A7I2V326 | A0A7I2V326_HUMAN | G3BP1 | 110 | ||
A0A7I2V2X7 | A0A7I2V2X7_HUMAN | G3BP1 | 49 | ||
A0A7I2V2S5 | A0A7I2V2S5_HUMAN | G3BP1 | 170 | ||
A0A7I2V2V1 | A0A7I2V2V1_HUMAN | G3BP1 | 151 | ||
A0A7I2V3C4 | A0A7I2V3C4_HUMAN | G3BP1 | 66 | ||
A0A7I2V3Y4 | A0A7I2V3Y4_HUMAN | G3BP1 | 59 | ||
A0A7I2V3V2 | A0A7I2V3V2_HUMAN | G3BP1 | 39 | ||
A0A7I2V494 | A0A7I2V494_HUMAN | G3BP1 | 54 | ||
A0A7I2V496 | A0A7I2V496_HUMAN | G3BP1 | 61 | ||
A0A7I2V4D8 | A0A7I2V4D8_HUMAN | G3BP1 | 49 | ||
A0A7I2V548 | A0A7I2V548_HUMAN | G3BP1 | 158 | ||
A0A7I2V565 | A0A7I2V565_HUMAN | G3BP1 | 74 | ||
A0A7I2V533 | A0A7I2V533_HUMAN | G3BP1 | 37 | ||
A0A7I2V4Y8 | A0A7I2V4Y8_HUMAN | G3BP1 | 56 | ||
A0A7I2V5H1 | A0A7I2V5H1_HUMAN | G3BP1 | 114 | ||
A0A7I2V5M7 | A0A7I2V5M7_HUMAN | G3BP1 | 476 | ||
A0A7I2V651 | A0A7I2V651_HUMAN | G3BP1 | 304 |
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 117 | |||||
Sequence: E |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC091982 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |