E3W0T5 · E3W0T5_9ROSI
- ProteinATP synthase subunit beta, chloroplastic
- GeneatpB
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids498 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits.
Catalytic activity
- ATP + 4 H+(in) + H2O = ADP + 5 H+(out) + phosphate
CHEBI:30616 + 4 H+ (in)CHEBI:15378+ CHEBI:15377 = CHEBI:456216 + 5 H+ (out)CHEBI:15378+ CHEBI:43474
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | proton-transporting ATP synthase complex, catalytic core F(1) | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | proton-transporting ATP synthase activity, rotational mechanism | |
Molecular Function | proton-transporting ATPase activity, rotational mechanism |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameATP synthase subunit beta, chloroplastic
- EC number
- Alternative names
Gene names
Encoded on
- Chloroplast
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fagales > Fagaceae > Castanea
Accessions
- Primary accessionE3W0T5
Subcellular Location
UniProt Annotation
GO Annotation
Plastid, chloroplast thylakoid membrane ; Peripheral membrane protein
Keywords
- Cellular component
Interaction
Subunit
F-type ATPases have 2 components, CF1 - the catalytic core - and CF0 - the membrane proton channel. CF1 has five subunits: alpha3, beta3, gamma1, delta1, epsilon1. CF0 has four main subunits: a1, b1, b'1 and c(9-12).
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 164-356 | AAA+ ATPase | ||||
Sequence: RGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGL |
Sequence similarities
Belongs to the ATPase alpha/beta chains family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length498
- Mass (Da)53,828
- Last updated2011-01-11 v1
- Checksum15FA5C0E653F8E89
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
HQ336406 EMBL· GenBank· DDBJ | ADO65067.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KY951992 EMBL· GenBank· DDBJ | ASD34260.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK352487 EMBL· GenBank· DDBJ | QID76224.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MW322901 EMBL· GenBank· DDBJ | QQV68846.1 EMBL· GenBank· DDBJ | Genomic DNA |