E3V1H8 · E3V1H8_PINSY
- Protein6-phosphogluconate dehydrogenase, decarboxylating
- Gene6pgdB
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids483 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO2, with concomitant reduction of NADP to NADPH.
Catalytic activity
- 6-phospho-D-gluconate + NADP+ = CO2 + D-ribulose 5-phosphate + NADPH
Pathway
Carbohydrate degradation; pentose phosphate pathway; D-ribulose 5-phosphate from D-glucose 6-phosphate (oxidative stage): step 3/3.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 13-18 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: GLAVMG | ||||||
Binding site | 36-38 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: NRS | ||||||
Binding site | 80-82 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: VKA | ||||||
Binding site | 108 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 108 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: N | ||||||
Binding site | 134-136 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: SGG | ||||||
Active site | 188 | Proton acceptor | ||||
Sequence: K | ||||||
Binding site | 191-192 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: HN | ||||||
Active site | 195 | Proton donor | ||||
Sequence: E | ||||||
Binding site | 196 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: Y | ||||||
Binding site | 266 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: K | ||||||
Binding site | 293 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: R | ||||||
Binding site | 453 | substrate; ligand shared between dimeric partners | ||||
Sequence: R | ||||||
Binding site | 459 | substrate; ligand shared between dimeric partners | ||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | NADP binding | |
Molecular Function | phosphogluconate dehydrogenase (decarboxylating) activity | |
Biological Process | D-gluconate catabolic process | |
Biological Process | pentose-phosphate shunt, oxidative branch |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended name6-phosphogluconate dehydrogenase, decarboxylating
- EC number
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Pinopsida > Pinidae > Conifers I > Pinales > Pinaceae > Pinus > Pinus subgen. Pinus
Accessions
- Primary accessionE3V1H8
Subcellular Location
UniProt Annotation
GO Annotation
Interaction
Subunit
Homodimer.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 184-475 | 6-phosphogluconate dehydrogenase C-terminal | ||||
Sequence: GNFVKMVHNGIEYGDMQLIAEAYDVLKSVGKLTNEELHQAFDTWNKGELCSFLIEITADIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAADLSVAAPTIAASLDSRFLSGLKEERVEASKVFKNVDVGTVPDLDKTKLIDDVRRALYASKICSYAQGMNLIRAKSMERGWDLKLGELARIWKGGCIIRAIFLDRIKKAYDRNPDLFNLLVDPEFAKEMIERQSAWRRVVTLAINAGVSVPGMSASLAYFDSYRRETLPANLVQAQRDYFGAHTYERIDMPGFFHTEWF |
Sequence similarities
Belongs to the 6-phosphogluconate dehydrogenase family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length483
- Mass (Da)53,286
- Last updated2011-01-11 v1
- Checksum177E4254883EE875