E3PJ88 · ASPS2_ECOH1
- ProteinPilotin AspS 2
- GenegspS2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids136 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Part of a type II secretion system (T2SS, formerly general secretion pathway, GSP) for the export of folded proteins across the outer membrane (Probable). Required for correct assembly of the type II secretion system-beta (T2SS-beta), for localization of GspD-beta to the cell outer membrane and for export of a labile enterotoxin by T2SS-beta (PubMed:22585966).
Each AspS2 binds to 2 GspD2 subunits and may clamp the monomers together, stabilizing structure and accelerating its assembly (PubMed:29632366).
Each AspS2 binds to 2 GspD2 subunits and may clamp the monomers together, stabilizing structure and accelerating its assembly (PubMed:29632366).
Miscellaneous
Encoded in a type II secretion system (T2SS-beta); this strain encodes 2 T2SS but only this one (beta) is expressed under standard laboratory conditions.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell outer membrane |
Names & Taxonomy
Protein names
- Recommended namePilotin AspS 2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Escherichia
Accessions
- Primary accessionE3PJ88
Subcellular Location
UniProt Annotation
GO Annotation
Cell outer membrane ; Lipid-anchor
Note: Protein can also be located in the cell inner membrane.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Severely disrupts assembly and function of T2SS-beta, mislocalization of GspD-beta to the cell inner membrane.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 25 | Precursor protein is not processed. | ||||
Sequence: C → A | ||||||
Mutagenesis | 26-27 | Protein is found almost exclusively in the inner membrane, does not restore targeting of GspD-beta to the outer membrane. | ||||
Sequence: AS → DD |
PTM/Processing
Features
Showing features for signal, lipidation, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-24 | |||||
Sequence: MSIKQMPGRVLISLLLSVTGLLSG | ||||||
Lipidation | 25 | N-palmitoyl cysteine | ||||
Sequence: C | ||||||
Lipidation | 25 | S-diacylglycerol cysteine | ||||
Sequence: C | ||||||
Chain | PRO_5003179701 | 25-136 | Pilotin AspS 2 | |||
Sequence: CASHNENASLLAKKQAQNISQNLPIKSAGYTLVLAQSSGTTVKMTIISEAGTQTTQTPDAFLTSYQRQMCADPTVKLMLTEGINYSITINDTRTGNQYQRKLDRTTCGIVKA | ||||||
Disulfide bond | 94↔131 | |||||
Sequence: CADPTVKLMLTEGINYSITINDTRTGNQYQRKLDRTTC |
Keywords
- PTM
Interaction
Subunit
Cryo-electron microscopy shows the complex forms a cylindrical channel with 15 GspD2 subunits, each of which interacts with its surroundingy AspS2 (GspS-beta).
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length136
- Mass (Da)14,670
- Last updated2011-01-11 v1
- Checksum8CF2819C427D869A
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
FN649414 EMBL· GenBank· DDBJ | CBJ02739.1 EMBL· GenBank· DDBJ | Genomic DNA |