E1BPQ4 · E1BPQ4_BOVIN

  • Protein
    High mobility group AT-hook 2
  • Gene
    HMGA2
  • Status
    UniProtKB unreviewed (TrEMBL)
  • Amino acids
  • Protein existence
    Evidence at protein level
  • Annotation score
    5/5

Function

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentnuclear chromosome
Cellular Componentnucleus
Cellular Componentprotein-DNA complex
Cellular Componentsenescence-associated heterochromatin focus
Cellular ComponentSMAD protein complex
Molecular Function5'-deoxyribose-5-phosphate lyase activity
Molecular FunctionC2H2 zinc finger domain binding
Molecular FunctioncAMP response element binding
Molecular FunctionDNA binding, bending
Molecular FunctionDNA-(apurinic or apyrimidinic site) endonuclease activity
Molecular FunctionMH1 domain binding
Molecular FunctionMH2 domain binding
Molecular Functionminor groove of adenine-thymine-rich DNA binding
Molecular Functionnucleosomal DNA binding
Molecular Functiontranscription cis-regulatory region binding
Molecular Functiontranscription coregulator activity
Molecular Functiontranscription corepressor activity
Biological Processbase-excision repair
Biological Processchondrocyte differentiation
Biological Processchondrocyte proliferation
Biological Processendodermal cell differentiation
Biological Processepithelial to mesenchymal transition
Biological Processfat cell differentiation
Biological Processheterochromatin formation
Biological Processintracellular signal transduction
Biological Processmesenchymal cell differentiation
Biological Processmesodermal cell differentiation
Biological Processmesodermal-endodermal cell signaling
Biological Processnegative regulation by host of viral transcription
Biological Processnegative regulation of apoptotic process
Biological Processnegative regulation of DNA binding
Biological Processnegative regulation of DNA-templated transcription
Biological Processnegative regulation of double-strand break repair via nonhomologous end joining
Biological Processnegative regulation of single stranded viral RNA replication via double stranded DNA intermediate
Biological Processnegative regulation of transcription by RNA polymerase II
Biological Processoncogene-induced cell senescence
Biological Processpositive regulation of gene expression
Biological Processpositive regulation of protein serine/threonine kinase activity
Biological Processpositive regulation of stem cell proliferation
Biological Processpositive regulation of transcription by RNA polymerase II
Biological Processregulation of cell cycle process
Biological Processregulation of DNA-templated transcription
Biological Processregulation of stem cell population maintenance

Keywords

Names & Taxonomy

Protein names

  • Submitted names
    • High mobility group AT-hook 2

Gene names

    • Name
      HMGA2

Organism names

  • Taxonomic identifier
  • Organism
  • Strain
    • Hereford
  • Taxonomic lineage
    Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Ruminantia > Pecora > Bovidae > Bovinae > Bos

Accessions

  • Primary accession
    E1BPQ4

Proteomes

Organism-specific databases

Subcellular Location

PTM/Processing

Keywords

Proteomic databases

Expression

Gene expression databases

Interaction

Protein-protein interaction databases

Family & Domains

Features

Showing features for compositional bias, region.

TypeIDPosition(s)Description
Compositional bias1-20Polar residues
Region1-109Disordered

Sequence similarities

Belongs to the HMGA family.

Keywords

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    109
  • Mass (Da)
    11,832
  • Last updated
    2011-11-16 v2
  • Checksum
    F36BABE623DA4615
MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED

Computationally mapped potential isoform sequences

There are 2 potential isoforms mapped to this entry

View all
EntryEntry nameGene nameLength
A0AAA9T7V3A0AAA9T7V3_BOVINHMGA2128
A0AAA9SS31A0AAA9SS31_BOVINHMGA2178

Features

Showing features for compositional bias.

TypeIDPosition(s)Description
Compositional bias1-20Polar residues

Keywords

Sequence databases

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp