D8SYK1 · D8SYK1_SELML
- Proteinglutathione dehydrogenase (ascorbate)
- GeneDHAR1
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids218 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
Catalytic activity
- 2 glutathione + L-dehydroascorbate = glutathione disulfide + L-ascorbate
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | glutathione dehydrogenase (ascorbate) activity | |
Molecular Function | glutathione transferase activity | |
Biological Process | ascorbate glutathione cycle |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameglutathione dehydrogenase (ascorbate)
- EC number
Gene names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Lycopodiopsida > Selaginellales > Selaginellaceae > Selaginella
Accessions
- Primary accessionD8SYK1
Proteomes
Genome annotation databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 16-94 | GST N-terminal | ||||
Sequence: ANGDPSRLGDCPFSQRVLLTLEEKGIPYNSKFVDMENKPAWFLEANPEGKVPVVKDDGKWVADSDVITQLIETKFPSPS | ||||||
Domain | 72-218 | GST C-terminal | ||||
Sequence: DGKWVADSDVITQLIETKFPSPSLVTPPEKSSVGSKIFSSFVKFLKSKDPSDGSEAALLEELKTLDEYLAKNGPFVNGSNISAVDLSLAPKLYHLKIALGHYKQWSVPQNLTNLNSYMEALFKRESFQKTMAPAEVVVKGWAKHLSA |
Sequence similarities
Belongs to the GST superfamily. DHAR family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length218
- Mass (Da)23,929
- Last updated2010-10-05 v1
- Checksum1B6DF1E24D532DE3
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KM061720 EMBL· GenBank· DDBJ | AIQ78400.1 EMBL· GenBank· DDBJ | mRNA | ||
GL377653 EMBL· GenBank· DDBJ | EFJ10536.1 EMBL· GenBank· DDBJ | Genomic DNA |