D4ZA31 · D4ZA31_BPAR1
- ProteinRNA ligase 1
- GenernlA
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids374 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Involved in countering a host defense mechanism which, following viral infection, activates the host anticodon nuclease and shuts off viral translation. Repairs 5'-PO4 and 3'-OH groups in the cleaved host tRNA.
Catalytic activity
Cofactor
Note: Binds 2 magnesium ions that perform the catalytic activity via a two-metal mechanism. One of the catalytic Mg2+, which is coordinated by 5 water molecules, engages the lysine nucleophile and the ATP alpha phosphate while the Mg2+ orients the PPi leaving group.
Features
Showing features for binding site, active site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 37 | ATP (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 54 | ATP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 75 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Active site | 99 | N6-AMP-lysine intermediate | ||||
Sequence: K | ||||||
Binding site | 159 | ATP (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Site | 159 | Essential for RNA ligase activity | ||||
Sequence: E | ||||||
Binding site | 240 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 242 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Site | 246 | Essential for RNA ligase activity | ||||
Sequence: Y | ||||||
Binding site | 272 | Mg2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: D |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | ATP binding | |
Molecular Function | metal ion binding | |
Molecular Function | RNA ligase (ATP) activity | |
Biological Process | RNA repair |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRNA ligase 1
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Uroviricota > Caudoviricetes > Straboviridae > Tevenvirinae > Tequatrovirus > Tequatrovirus ar1
- Virus hosts
Accessions
- Primary accessionD4ZA31
Proteomes
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 52-246 | T4 RNA ligase 1-like N-terminal | ||||
Sequence: ECRGIMFEMDGEKPVRIASRPMEKFFNLNENPFTMNIDLNDVDYILTKEDGSLVSTYLDGDEILFKSKGSIKSEQALMANGILMNINHHQLRDRLKELAEDGFTANFEFVAPTNRIVLAYQEMKIILLNIRENETGEYISYDDIYKDAALRPYLVERYEIDSPKWVEEAKNAENIEGYVAVMKDGSHFKIKSDWY | ||||||
Domain | 253-374 | T4 RNA ligase 1 C-terminal | ||||
Sequence: KSSLDNPEKLFKTIIDGASDDLKAMYADDEYSYRKIEAFETTYLKYLDRALFLVLDCHNKHCGKDRKTYAMEAQGVAKGAGMDHLFGIIMSLYQGYDSQEKVMCEIEQNFLKNYKKFIPEGY |
Sequence similarities
Belongs to the Tequatrovirus RNA ligase 1 family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length374
- Mass (Da)43,451
- Last updated2010-06-15 v1
- Checksum0378DFCD25C0BC99
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP011113 EMBL· GenBank· DDBJ | BAI83243.1 EMBL· GenBank· DDBJ | Genomic DNA |