D4P061 · D4P061_HRSV
- ProteinMajor surface glycoprotein G
- GeneG
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Isoform Secreted glycoprotein G
Helps the virus escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fc-gamma receptors.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | host cell plasma membrane | |
Cellular Component | plasma membrane | |
Cellular Component | virion membrane | |
Biological Process | symbiont entry into host cell | |
Biological Process | virion attachment to host cell | |
Biological Process | virus-mediated perturbation of host defense response |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameMajor surface glycoprotein G
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Negarnaviricota > Haploviricotina > Monjiviricetes > Mononegavirales > Pneumoviridae > Orthopneumovirus > Orthopneumovirus hominis
- Virus hosts
Accessions
- Primary accessionD4P061
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type II membrane protein
Host cell membrane ; Single-pass type II membrane protein
Membrane ; Single-pass type II membrane protein
Virion membrane ; Single-pass type II membrane protein
Keywords
- Cellular component
Interaction
Subunit
Isoform Membrane-bound glycoprotein G
Homooligomer. Interacts (via N-terminus) with protein M. Part of a complex composed of F1, F2 and G glycoproteins. Interacts with protein SH. Interacts with host heparate sulfate; this interaction probably participates in the viral attachment to the host cell.
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-97 | Disordered | ||||
Sequence: PAKPLKKETTINPTKKPTPKITERDTSTPQSTVLDTTASKHTERDTSTSQSIVLNTTTSKHTIRQQSLYSTTPENTPNSTQTPTASEPSTSNSNQKL | ||||||
Compositional bias | 11-97 | Polar residues | ||||
Sequence: INPTKKPTPKITERDTSTPQSTVLDTTASKHTERDTSTSQSIVLNTTTSKHTIRQQSLYSTTPENTPNSTQTPTASEPSTSNSNQKL |
Sequence similarities
Belongs to the pneumoviruses glycoprotein G family.
Family and domain databases
Sequence
- Sequence statusFragment
- Length97
- Mass (Da)10,569
- Last updated2010-05-18 v1
- Checksum6B18B468FD325CD8
Features
Showing features for non-terminal residue, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: P | ||||||
Compositional bias | 11-97 | Polar residues | ||||
Sequence: INPTKKPTPKITERDTSTPQSTVLDTTASKHTERDTSTSQSIVLNTTTSKHTIRQQSLYSTTPENTPNSTQTPTASEPSTSNSNQKL |