D4GWY2 · FLGA2_HALVD
- ProteinFlagellin A2
- GeneflgA2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids220 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Flagellin that plays both structural and regulatory roles in flagella biosynthesis. Does not constitute a major flagellin in terms of abundance contrary to FlgA1: may regulate the flagella-dependent swimming motility depending on the relative abundance of FlgA1. Not involved in PibD-dependent surface adhesion.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | archaeal-type flagellum | |
Molecular Function | structural molecule activity | |
Biological Process | archaeal or bacterial-type flagellum-dependent cell motility |
Names & Taxonomy
Protein names
- Recommended nameFlagellin A2
Gene names
Organism names
- Strain
- Taxonomic lineageArchaea > Euryarchaeota > Stenosarchaea group > Halobacteria > Halobacteriales > Haloferacaceae > Haloferax
Accessions
- Primary accessionD4GWY2
- Secondary accessions
Proteomes
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Straight flagella, mainly at the poles (PubMed:10632878).
Cells lacking flgA2 but not flgA1 are hypermotile, display an increased number of flagella per cell, as well as an increased flagellum length (PubMed:23989184).
Cells lacking both flgA1 and flgA2 show defects in motility, whitout affecting surface adhesion ability (PubMed:20363933).
Cells lacking flgA2 but not flgA1 are hypermotile, display an increased number of flagella per cell, as well as an increased flagellum length (PubMed:23989184).
Cells lacking both flgA1 and flgA2 show defects in motility, whitout affecting surface adhesion ability (PubMed:20363933).
PTM/Processing
Features
Showing features for propeptide, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Propeptide | PRO_0000429055 | 1-11 | ||||
Sequence: MFNNITDDDRG | ||||||
Chain | PRO_0000429054 | 1-220 | Flagellin A2 | |||
Sequence: MFNNITDDDRGQVGIGTLIVFIAMVLVAAIAAGVLVNTAGFLQATAEDAGEQSVNKVTNRVEVLNTHGTVGGEEDIDNITLTVRLAAGSDAVDMNETSIKYLSGDSVVTLTNQTVTSGANSATNDSAEGVADSDEFGLSEVTDDDGSFGVLNSMNDRYEVTIDTAAIETSDGDNTNLIGGLSTGEQVTLEITSRTGGTTQVILTMPQQLAGKTQNEPVEL | ||||||
Glycosylation | 78 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 95 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 112 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 124 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
Glycosylated by a pentasaccharide similar to the S-layer glycoprotein, probably comprising a hexose, 2 hexuronic acids, a methyl ester of a hexuronic acid and mannose.
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length220
- Mass (Da)22,810
- Last updated2010-05-18 v1
- Checksum8F87AC8E05F80C90
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP001956 EMBL· GenBank· DDBJ | ADE03249.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AOHU01000091 EMBL· GenBank· DDBJ | ELY28104.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation |