D4ABW7 · LYZL4_RAT
- ProteinLysozyme-like protein 4
- GeneLyzl4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids145 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
May be involved in fertilization (By similarity).
Has no detectable bacteriolytic and lysozyme activities in vitro (PubMed:22110709).
Has no detectable bacteriolytic and lysozyme activities in vitro (PubMed:22110709).
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 54 | |||||
Sequence: E |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | acrosomal vesicle | |
Cellular Component | extracellular space | |
Cellular Component | sperm flagellum | |
Biological Process | fertilization | |
Biological Process | fusion of sperm to egg plasma membrane involved in single fertilization |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameLysozyme-like protein 4
- Short namesLysozyme-4
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionD4ABW7
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Found in the principal piece of sperm tail.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-19 | |||||
Sequence: MQLYLVLLLISYLLTPIGA | ||||||
Chain | PRO_5008161378 | 20-145 | Lysozyme-like protein 4 | |||
Sequence: SILGRCVVAKKLYDGGLNYFEGYSLENWVCLAYFESKFNPSAVYENSRDGSTGFGLFQIRDNEWCDHGKNLCSVSCTALLNPNLKDTIECAKKIVKGKQGMGAWPVWSRNCQLSDILDRWLDGCEL | ||||||
Disulfide bond | 25↔143 | |||||
Sequence: CVVAKKLYDGGLNYFEGYSLENWVCLAYFESKFNPSAVYENSRDGSTGFGLFQIRDNEWCDHGKNLCSVSCTALLNPNLKDTIECAKKIVKGKQGMGAWPVWSRNCQLSDILDRWLDGC | ||||||
Disulfide bond | 49↔130 | |||||
Sequence: CLAYFESKFNPSAVYENSRDGSTGFGLFQIRDNEWCDHGKNLCSVSCTALLNPNLKDTIECAKKIVKGKQGMGAWPVWSRNC | ||||||
Disulfide bond | 84↔95 | |||||
Sequence: CDHGKNLCSVSC | ||||||
Disulfide bond | 91↔109 | |||||
Sequence: CSVSCTALLNPNLKDTIEC |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the brain, lung, ovary, uterus and testis (PubMed:22110709).
In testis expressed in the germinal epithelium and on the maturing spermatozoa (at protein level) (PubMed:22110709).
In testis expressed in the germinal epithelium and on the maturing spermatozoa (at protein level) (PubMed:22110709).
Developmental stage
Present during stages of postnatal development from 10 to 60 days old (PubMed:22110709).
Gene expression databases
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 20-145 | C-type lysozyme | ||||
Sequence: SILGRCVVAKKLYDGGLNYFEGYSLENWVCLAYFESKFNPSAVYENSRDGSTGFGLFQIRDNEWCDHGKNLCSVSCTALLNPNLKDTIECAKKIVKGKQGMGAWPVWSRNCQLSDILDRWLDGCEL |
Sequence similarities
Belongs to the glycosyl hydrolase 22 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length145
- Mass (Da)16,302
- Last updated2010-04-20 v1
- Checksum130FF4FCACC68E6A
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8I6ACK3 | A0A8I6ACK3_RAT | Lyzl4 | 245 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
HM125534 EMBL· GenBank· DDBJ | ADK94117.1 EMBL· GenBank· DDBJ | mRNA | ||
AABR07071764 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH473954 EMBL· GenBank· DDBJ | EDL76834.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
HG931781 EMBL· GenBank· DDBJ | CDM98782.1 EMBL· GenBank· DDBJ | Genomic DNA |