D3ZQF4 · FKBP6_RAT
- ProteinInactive peptidyl-prolyl cis-trans isomerase FKBP6
- GeneFkbp6
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids327 (go to sequence)
- Protein existenceInferred from homology
- Annotation score5/5
Function
function
Co-chaperone required during spermatogenesis to repress transposable elements and prevent their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Acts as a co-chaperone via its interaction with HSP90 and is required for the piRNA amplification process, the secondary piRNA biogenesis. May be required together with HSP90 in removal of 16 nucleotide ping-pong by-products from Piwi complexes, possibly facilitating turnover of Piwi complexes (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | synaptonemal complex | |
Molecular Function | Hsp90 protein binding | |
Molecular Function | identical protein binding | |
Biological Process | cell differentiation | |
Biological Process | meiotic cell cycle | |
Biological Process | piRNA processing | |
Biological Process | positive regulation of viral genome replication | |
Biological Process | protein folding | |
Biological Process | regulatory ncRNA-mediated gene silencing | |
Biological Process | retrotransposon silencing by piRNA-directed DNA methylation | |
Biological Process | siRNA-mediated retrotransposon silencing by heterochromatin formation | |
Biological Process | spermatogenesis |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameInactive peptidyl-prolyl cis-trans isomerase FKBP6
- Short namesInactive PPIase FKBP6
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionD3ZQF4
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Does not localize to pi-bodies. Localizes to meiotic chromosome cores and regions of homologous chromosome synapsis (By similarity).
Keywords
- Cellular component
Phenotypes & Variants
Involvement in disease
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000428726 | 1-327 | Inactive peptidyl-prolyl cis-trans isomerase FKBP6 | |||
Sequence: MSVFSRLRNGIPPSRDDCQSPYERLSQRMLDISGDRGVLKDIIREGAGDPVTPDASVLVKYSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPTYAYGTLGCPPLIPPNATVLFEIELIDFLDSAESDKFCALSAEQQEQFPLQKVLKVAATEREFGNYLFRQNRFCDAKVRYKRALLLLHRRLAICEEQHLVEPAELLVLLNLSFVYLKLDRPAMALRYGEQALLIDKRNAKALFRCGQACLLLTEYEQARDFLVRAQKEQPCNHDINNELKKLSSHYRDYVDREREMCHRMFAPCGSGSSVGGN |
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Interacts with HSP72/HSPA2 and CLTC. Interacts with GAPDH; leading to inhibit GAPDH catalytic activity. Interacts (via TPR repeats) with HSP90 (By similarity).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-20 | Disordered | ||||
Sequence: MSVFSRLRNGIPPSRDDCQS | ||||||
Domain | 54-143 | PPIase FKBP-type | ||||
Sequence: DASVLVKYSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPTYAYGTLGCPPLIPPNATVLFEIELIDFL | ||||||
Repeat | 171-204 | TPR 1 | ||||
Sequence: AATEREFGNYLFRQNRFCDAKVRYKRALLLLHRR | ||||||
Repeat | 219-252 | TPR 2 | ||||
Sequence: LLVLLNLSFVYLKLDRPAMALRYGEQALLIDKRN | ||||||
Repeat | 253-286 | TPR 3 | ||||
Sequence: AKALFRCGQACLLLTEYEQARDFLVRAQKEQPCN |
Sequence similarities
Belongs to the FKBP6 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length327
- Mass (Da)37,455
- Last updated2010-04-20 v1
- Checksum0E68789E4E93FADC
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8I6A6Z3 | A0A8I6A6Z3_RAT | Fkbp6 | 287 | ||
A0A8I5ZW77 | A0A8I5ZW77_RAT | Fkbp6 | 327 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AABR06071167 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH473973 EMBL· GenBank· DDBJ | EDM13376.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH473973 EMBL· GenBank· DDBJ | EDM13377.1 EMBL· GenBank· DDBJ | Genomic DNA |