D3Z1U7 · TM233_MOUSE
- ProteinTransmembrane protein 233
- GeneTmem233
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids110 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Probable accessory protein of voltage-gated sodium channels.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Cellular Component | plasma membrane |
Names & Taxonomy
Protein names
- Recommended nameTransmembrane protein 233
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionD3Z1U7
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Single-pass membrane protein
Features
Showing features for topological domain, intramembrane, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-42 | Cytoplasmic | ||||
Sequence: MSQYASRSDSKGALDSSSPEAYTEDDKTEEDIPAPSNYLWLT | ||||||
Intramembrane | 43-63 | Helical | ||||
Sequence: IISCFCPAYPVNIVALVFSIM | ||||||
Topological domain | 64-85 | Cytoplasmic | ||||
Sequence: SLNSYNDGDYEGARRLGRNAKW | ||||||
Transmembrane | 86-106 | Helical | ||||
Sequence: VAIASIIIGLVIIGVSCAVHF | ||||||
Topological domain | 107-110 | Extracellular | ||||
Sequence: SRNP |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Decrease in pain behaviors (paw licks and flinches) following intraplantar injection of ExTxA toxin.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 2 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000394963 | 1-110 | Transmembrane protein 233 | |||
Sequence: MSQYASRSDSKGALDSSSPEAYTEDDKTEEDIPAPSNYLWLTIISCFCPAYPVNIVALVFSIMSLNSYNDGDYEGARRLGRNAKWVAIASIIIGLVIIGVSCAVHFSRNP |
Proteomic databases
PTM databases
Expression
Tissue specificity
Probably expressed in nociceptive neurons. Detected in dorsal root ganglion neurons.
Gene expression databases
Interaction
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-17 | Polar residues | ||||
Sequence: MSQYASRSDSKGALDSS | ||||||
Region | 1-32 | Disordered | ||||
Sequence: MSQYASRSDSKGALDSSSPEAYTEDDKTEEDI |
Sequence similarities
Belongs to the CD225/Dispanin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length110
- Mass (Da)11,997
- Last updated2010-06-15 v2
- Checksum5B6CE965CE732CD1
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0A0MQE1 | A0A0A0MQE1_MOUSE | Tmem233 | 135 |
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-17 | Polar residues | ||||
Sequence: MSQYASRSDSKGALDSS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC115795 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH466529 EMBL· GenBank· DDBJ | EDL19832.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation |