D3YYM4 · WDR72_MOUSE
- ProteinWD repeat-containing protein 72
- GeneWdr72
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1114 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Plays a major role in formation of tooth enamel (PubMed:25008349, PubMed:26247047).
Specifically required during the maturation phase of amelogenesis for normal formation of the enamel matrix and clearance of enamel proteins (PubMed:25008349, PubMed:26247047).
May be involved in localization of the calcium transporter SLC24A4 to the ameloblast cell membrane (PubMed:26247047).
Specifically required during the maturation phase of amelogenesis for normal formation of the enamel matrix and clearance of enamel proteins (PubMed:25008349, PubMed:26247047).
May be involved in localization of the calcium transporter SLC24A4 to the ameloblast cell membrane (PubMed:26247047).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | endosome | |
Cellular Component | nucleus | |
Biological Process | enamel mineralization | |
Biological Process | extracellular matrix disassembly | |
Biological Process | protein localization to plasma membrane |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameWD repeat-containing protein 72
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionD3YYM4
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Viable with no gross morpholgical defects (PubMed:25008349, PubMed:26247047).
At 6-7 weeks of age teeth have an opaque, chalky appearance, with reduced enamel thickness at occlusal surfaces (PubMed:25008349, PubMed:26247047).
Body weight is reduced, probably due to problems with chewing hard foods (PubMed:25008349).
Enamel formation is abnormal from the maturation stage onwards with significantly reduced mineral density and retention of proteinaceous material in the enamel matrix (PubMed:25008349, PubMed:26247047).
Tooth enamel hardness is ten times lower than wild type (PubMed:26247047).
Attachment of ameloblasts to the enamel layer may be weakened (PubMed:26247047).
The calcium transporter SLC24A4 fails to localize to the distal ameloblast membrane (PubMed:26247047).
In maturation stage ameloblasts expression levels of amelogenin appear to be reduced, although abnormally high amelogenin levels are found in the extracellular enamel matrix (PubMed:25008349, PubMed:26247047).
At 6-7 weeks of age teeth have an opaque, chalky appearance, with reduced enamel thickness at occlusal surfaces (PubMed:25008349, PubMed:26247047).
Body weight is reduced, probably due to problems with chewing hard foods (PubMed:25008349).
Enamel formation is abnormal from the maturation stage onwards with significantly reduced mineral density and retention of proteinaceous material in the enamel matrix (PubMed:25008349, PubMed:26247047).
Tooth enamel hardness is ten times lower than wild type (PubMed:26247047).
Attachment of ameloblasts to the enamel layer may be weakened (PubMed:26247047).
The calcium transporter SLC24A4 fails to localize to the distal ameloblast membrane (PubMed:26247047).
In maturation stage ameloblasts expression levels of amelogenin appear to be reduced, although abnormally high amelogenin levels are found in the extracellular enamel matrix (PubMed:25008349, PubMed:26247047).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 63 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000438188 | 1-1114 | WD repeat-containing protein 72 | |||
Sequence: MRGALQAVALWGRKAPPHSITAIMITDDQQTIVTGSQEGQLCLWSLSPELKISAKELLFGHSASVTCLARARDFSKQPYVVSAAENGEMCMWNVSSGQCVEKTSLPYRHTAICYYHCSFRMTGEGWLLCCGEYQDVLVLDAGTLAVLHTFTSLQSPDWMKCMCIVHSVRIQEDSLLVVSITGELKVWDLSSSINSIQEKQDVHEKESKFLDSFNCQTIRFCPYTERLLLVVFSKCWKIYDYCDFSLLWTEVSRDGQFFAGGEVLAAHRILVWTEDGHSYIYQLLNRWAQMGATLRTFSGLSKCVCPADGGVLKGTVYPHLLCSTSVEENKSLHFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPISKFDGSPREIPITTTWTLQDNFDKHQMVSQSITDHFSGSRDEVGMTATITSSEYIPNLDKLICGCEDGTIFITKALNAAKAGLLEGDSLLKDSPCHTLLRGHHQSVTSLLYPHNLASKLDQSWMVSGDRGSYVILWDIFTEEILHTFFLEAGPVTRLLMSPENLKRSDGQILCCVCGDHSVALLHLEGRRCLLRARKHLFPVRMIRWHPVENFLIVGCTDDSVYIWEIETGTLERHETGERARIILNCGDDAQLIRSEPTLSVASETHKHKSIEQKSSNSHQPGPVPCPSVQLESSCKVADASSVPRPFNVLPVKTKWSHIGFHVLLFDLENLVELLLPTPLSDVDPSGSFYGGDILRRAKSTVEKKTLTIRRNKASCSSLQTEAQAKPSGDSLVLGDSTSKFSEENNGIKRQKKMKSSKKAHPKPPRKVDASLTIDMAKLFLSCILPWGVDKDLDSLCTRHLSILKLQGPVSLGLASNEDLFSLMLPGWDACSTEMKEYSGVNLCSRKVLDLSSKYTATLLHQTGIPRGLESHCDSVQQSDAIVYLLSRLFLVNKLVNMPLDLACEIDRPFKMETVHSKARFPGSDILNISSFYGHPKNGGNECRAPEADLSLLKLISCWRDQSVQVTEAIQAVLLAEVQQHMKSLRNTPVSSQPDPVAEHSICERMQISAKMEWTEELELQYVGKSSPLKTSVSPVKHGNDLNSANFQDTEDILDRCVLEESESAGQPRHRPWIAKVCSCRMC | ||||||
Modified residue | 1093 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 1095 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Gene expression databases
Structure
Family & Domains
Features
Showing features for repeat, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 15-54 | WD 1 | ||||
Sequence: APPHSITAIMITDDQQTIVTGSQEGQLCLWSLSPELKISA | ||||||
Repeat | 60-102 | WD 2 | ||||
Sequence: GHSASVTCLARARDFSKQPYVVSAAENGEMCMWNVSSGQCVEK | ||||||
Repeat | 160-197 | WD 3 | ||||
Sequence: KCMCIVHSVRIQEDSLLVVSITGELKVWDLSSSINSIQ | ||||||
Repeat | 327-373 | WD 4 | ||||
Sequence: EENKSLHFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPISKFD | ||||||
Repeat | 413-452 | WD 5 | ||||
Sequence: GMTATITSSEYIPNLDKLICGCEDGTIFITKALNAAKAGL | ||||||
Repeat | 470-515 | WD 6 | ||||
Sequence: GHHQSVTSLLYPHNLASKLDQSWMVSGDRGSYVILWDIFTEEILHT | ||||||
Repeat | 566-605 | WD 7 | ||||
Sequence: KHLFPVRMIRWHPVENFLIVGCTDDSVYIWEIETGTLERH | ||||||
Region | 634-658 | Disordered | ||||
Sequence: SETHKHKSIEQKSSNSHQPGPVPCP | ||||||
Compositional bias | 749-773 | Polar residues | ||||
Sequence: SLQTEAQAKPSGDSLVLGDSTSKFS | ||||||
Region | 749-798 | Disordered | ||||
Sequence: SLQTEAQAKPSGDSLVLGDSTSKFSEENNGIKRQKKMKSSKKAHPKPPRK |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,114
- Mass (Da)124,410
- Last updated2010-04-20 v1
- Checksum209D3BF22B75E72C
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1L1SR77 | A0A1L1SR77_MOUSE | Wdr72 | 1102 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 749-773 | Polar residues | ||||
Sequence: SLQTEAQAKPSGDSLVLGDSTSKFS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC108944 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC111087 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |