D3YN49 · GEMC1_XENLA
- ProteinGeminin coiled-coil domain-containing protein 1
- Genegmnc
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids316 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Regulator of DNA replication. Promotes initiation of chromosomal DNA replication by mediating topbp1- and cdk2-dependent recruitment of cdc45l onto replication origins.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | chromatin binding | |
Biological Process | DNA replication initiation |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameGeminin coiled-coil domain-containing protein 1
- Short namesxGEMC1
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Pipoidea > Pipidae > Xenopodinae > Xenopus > Xenopus
Accessions
- Primary accessionD3YN49
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Associates with chromatin during pre-replication complex (pre-RC) formation following interaction with topbp1.
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 153 | Can still be phosphorylated by cdk2 in vitro. Abolishes phosphorylation by cdk2; when associated with A-177; A-215; A-226; A-239; A-255; A-259 and A-264. | ||||
Sequence: T → A | ||||||
Mutagenesis | 163-165 | Strongly reduces phosphorylation and interaction with cdk2 without affecting interaction with cdc45l. | ||||
Sequence: RNL → ANA | ||||||
Mutagenesis | 177 | Abolishes phosphorylation by cdk2; when associated with A-153; A-215; A-226; A-239; A-255; A-259 and A-264. | ||||
Sequence: S → A | ||||||
Mutagenesis | 215 | Abolishes phosphorylation by cdk2; when associated with A-153; A-177; A-226; A-239; A-255; A-259 and A-264. | ||||
Sequence: S → A | ||||||
Mutagenesis | 226 | Abolishes phosphorylation by cdk2; when associated with A-153; A-177; A-215; A-239; A-255; A-259 and A-264. | ||||
Sequence: T → A | ||||||
Mutagenesis | 239 | Abolishes phosphorylation by cdk2; when associated with A-153; A-177; A-215; A-226; A-255; A-259 and A-264. | ||||
Sequence: S → A | ||||||
Mutagenesis | 255 | Abolishes phosphorylation by cdk2; when associated with A-153; A-177; A-215; A-226; A-239; A-259 and A-264. | ||||
Sequence: S → A | ||||||
Mutagenesis | 259 | Abolishes phosphorylation by cdk2; when associated with A-153; A-177; A-215; A-226; A-239; A-255 and A-264. | ||||
Sequence: S → A | ||||||
Mutagenesis | 264 | Abolishes phosphorylation by cdk2; when associated with A-153; A-177; A-215; A-226; A-239; A-255 and A-259. | ||||
Sequence: T → A |
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000395805 | 1-316 | Geminin coiled-coil domain-containing protein 1 | |||
Sequence: MNTILTCQDEYFAGGLGYDCPYFSSTSASTVDVSKETWVSLWASGLLDNRSSNHGPHTQGQLYNMGNSLQEDYLFGDQLSSQISANKQLQDTLLQKEEELSRLHEENNKLKEFLNSAFVKTLAEKTKKLLHQNGQSSFCTNPNSRVPFSSNSTPGSKAKRARRNLYGELTACEAQSSPVVEKWVLQTLGLKDVDTIDDSALANYSAMSLQPKQDSPSSGYSSAHLTPGHSQAATSCSLSPSQCSSASLPESETASPLSSPTYHTPDVAPNKTEVAFSTSLHPHCNVKTHSFPQGQAFVRRDTQGGWKFTWVPKQSE | ||||||
Modified residue | 153 | Phosphothreonine; by cdk2 | ||||
Sequence: T |
Post-translational modification
Highly phosphorylated by cdk2; stimulates initiation of DNA replication.
Keywords
- PTM
PTM databases
Expression
Tissue specificity
Expressed in most tissues. Enriched in proliferating cells from skin and gut.
Gene expression databases
Interaction
Subunit
Interacts with topbp1. Interacts with Cdc45l and the kinase cdk2-cyclin-E (the interaction is direct).
Structure
Family & Domains
Features
Showing features for coiled coil, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 82-117 | |||||
Sequence: QISANKQLQDTLLQKEEELSRLHEENNKLKEFLNSA | ||||||
Compositional bias | 134-158 | Polar residues | ||||
Sequence: GQSSFCTNPNSRVPFSSNSTPGSKA | ||||||
Region | 134-160 | Disordered | ||||
Sequence: GQSSFCTNPNSRVPFSSNSTPGSKAKR | ||||||
Region | 207-269 | Disordered | ||||
Sequence: MSLQPKQDSPSSGYSSAHLTPGHSQAATSCSLSPSQCSSASLPESETASPLSSPTYHTPDVAP |
Sequence similarities
Belongs to the GEMC1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length316
- Mass (Da)34,569
- Last updated2010-04-20 v1
- Checksum379F2E2D6E25085F
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 134-158 | Polar residues | ||||
Sequence: GQSSFCTNPNSRVPFSSNSTPGSKA |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
GU594151 EMBL· GenBank· DDBJ | ADC92603.1 EMBL· GenBank· DDBJ | mRNA |