D2KFH1 · AVLA4_WHEAT
- ProteinAvenin-like a4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids172 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
Seed storage protein. Not integrated in the gluten polymer through disulfide bonds, unless incorporated by reduction and reoxidation during dough making. Increases dough strength and bread volume, but decreases dough stability when added into a base wheat flour (By similarity).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | nutrient reservoir activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameAvenin-like a4
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Pooideae > Triticodae > Triticeae > Triticinae > Triticum
Accessions
- Primary accessionD2KFH1
Proteomes
Genome annotation databases
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-19 | |||||
Sequence: MKTMFILALIALAATSVVA | ||||||
Chain | PRO_0000410695 | 20-172 | Avenin-like a4 | |||
Sequence: QLDTTCSQGYGQCQQQPQQQVNTCSALLQQCSPTPYVQSQMWQASGCQLMRQQCCQPLAQISEQARCQAVCSVAQVIMRQQQGQSFGQPQQQVQSFSQPQHQVPIEITRMVLQTLPSMCNVNIPQYCTTTPCRTITQTPYNIPMSATCVGGTC |
Post-translational modification
Contains 7 disulfide bonds.
Keywords
- PTM
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length172
- Mass (Da)18,916
- Last updated2010-02-09 v1
- Checksum1650577B94AF6351
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
GU211170 EMBL· GenBank· DDBJ | ADA62374.1 EMBL· GenBank· DDBJ | mRNA |