D1YV03 · D1YV03_METPS
- ProteinPyrophosphate--fructose 6-phosphate 1-phosphotransferase
- Genepfp
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids345 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Catalyzes the phosphorylation of D-fructose 6-phosphate, the first committing step of glycolysis. Uses inorganic phosphate (PPi) as phosphoryl donor instead of ATP like common ATP-dependent phosphofructokinases (ATP-PFKs), which renders the reaction reversible, and can thus function both in glycolysis and gluconeogenesis. Consistently, PPi-PFK can replace the enzymes of both the forward (ATP-PFK) and reverse (fructose-bisphosphatase (FBPase)) reactions.
Catalytic activity
- beta-D-fructose 6-phosphate + diphosphate = beta-D-fructose 1,6-bisphosphate + H+ + phosphate
Cofactor
Activity regulation
Non-allosteric.
Pathway
Carbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 3/4.
Features
Showing features for binding site, site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 14 | diphosphate (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 106 | Mg2+ (UniProtKB | ChEBI); catalytic | ||||
Sequence: E | ||||||
Site | 107 | Important for catalytic activity and substrate specificity; stabilizes the transition state when the phosphoryl donor is PPi; prevents ATP from binding by mimicking the alpha-phosphate group of ATP | ||||
Sequence: D | ||||||
Site | 127 | Important for catalytic activity; stabilizes the transition state when the phosphoryl donor is PPi | ||||
Sequence: K | ||||||
Binding site | 128-130 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: TID | ||||||
Active site | 130 | Proton acceptor | ||||
Sequence: D | ||||||
Binding site | 165 | substrate; ligand shared between dimeric partners | ||||
Sequence: R | ||||||
Binding site | 172-174 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: MGR | ||||||
Binding site | 225 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: E | ||||||
Binding site | 269 | substrate; ligand shared between dimeric partners | ||||
Sequence: R | ||||||
Binding site | 275-278 | substrate; ligand shared between dimeric partners; in other chain | ||||
Sequence: HTQR |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | 6-phosphofructokinase activity | |
Molecular Function | ATP binding | |
Molecular Function | diphosphate-fructose-6-phosphate 1-phosphotransferase activity | |
Molecular Function | metal ion binding | |
Biological Process | fructose 6-phosphate metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePyrophosphate--fructose 6-phosphate 1-phosphotransferase
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageArchaea > Euryarchaeota > Stenosarchaea group > Methanomicrobia > Methanocellales > Methanocellaceae > Methanocella
Accessions
- Primary accessionD1YV03
Proteomes
Subcellular Location
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 6-301 | Phosphofructokinase | ||||
Sequence: KIGILTGGGDCPGLNAVIRAVVFKAGEYGWQVLGVKYGWKGMLNADAIPLTRNDVKDILPLGGTILKTSRTNPYKVEGGEAKVLENAKKMGIDCLVAVGGEDTLGVANKLTKAGLRCVGVPKTIDNDLGATDYTFGYQTAVQIASDAMDRLHTTAKSHDRVLVCEVMGRHAGWMTVDAGMSASAHWIYTPEAKGSVEDCCKMLKERYARGDKYGIVAVAEGAEFSDLDVKAASQTTDSFGHVKLGGVAETLAKEIEKRTGLETRHVVLGHTQRGGSPLAYDRILGTRLGNKAAEMI |
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length345
- Mass (Da)36,943
- Last updated2010-02-09 v1
- Checksum12D9C8F368566230
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP011532 EMBL· GenBank· DDBJ | BAI60275.1 EMBL· GenBank· DDBJ | Genomic DNA |