D1L2W8 · D1L2W8_BPK32
- ProteinInternal virion protein gp15
- Gene35
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids756 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Component of the cylindrical core that assembles on the inner surface of the capsid during capsid formation and plays a role in viral DNA ejection into the host cell. The inner core is composed of stacked rings of gp14, gp15 and gp16 proteins. Following binding to the host cell surface, the internal core is disassembled and gp15 is ejected along with gp14 and gp16 into the infected cell. Gp15 probably remains associated with gp16. The gp15-gp16 complex binds to both the viral DNA and the host inner membrane, probably escorting the leading end of the genome through the periplasm and controlling the extend of DNA translocated into the host cell.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell periplasmic space | |
Cellular Component | virion component | |
Biological Process | symbiont genome ejection through host cell envelope, short tail mechanism |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameInternal virion protein gp15
Gene names
Organism names
- Strain
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Uroviricota > Caudoviricetes > Autographiviridae > Studiervirinae > Przondovirus > Przondovirus KP32
- Virus hosts
Accessions
- Primary accessionD1L2W8
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: The gp15-gp16 complex spans the periplasm and the cytoplasmic membrane.
Keywords
- Cellular component
Interaction
Subunit
Homooctamer. Interacts with gp16; after ejection the gp15-gp16 complex composed of a gp15 octamer and a gp16 tetramer probably binds both the viral DNA and the host inner membrane. Interacts with gp14.
Structure
Family & Domains
Features
Showing features for coiled coil, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 688-717 | |||||
Sequence: KELLTRTYQEQQQRLAKEAEEKALKEATKR | ||||||
Region | 725-756 | Disordered | ||||
Sequence: QVRKDIKSGKRKGLAQRSQEFREQRLHRKPKE | ||||||
Compositional bias | 728-756 | Basic and acidic residues | ||||
Sequence: KDIKSGKRKGLAQRSQEFREQRLHRKPKE |
Sequence similarities
Belongs to the T7virus internal virion protein gp15 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length756
- Mass (Da)85,637
- Last updated2010-01-19 v1
- Checksum0802CF955FCFEFDF
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 728-756 | Basic and acidic residues | ||||
Sequence: KDIKSGKRKGLAQRSQEFREQRLHRKPKE |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
GQ413937 EMBL· GenBank· DDBJ | ACY66697.1 EMBL· GenBank· DDBJ | Genomic DNA |