D1L2W4 · TUBE1_BPK32
- ProteinTail tubular protein A
- Gene31
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids192 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Structural component of the tail, which functions as a receptor binding protein (RBP) and mediates the attachment to the host capsular exopolysaccharides (PubMed:28533535).
Displays a depolymerase activity that specifically degrades the polysaccharides of Klebsiella pneumoniae capsule, which allows the phage to reach the host cell membrane and bind the entry receptor (PubMed:28533535).
Hydrolyzes maltose (PubMed:29273737).
Does not hydrolyze alpha-lactose, beta-lactose, trehalose, melibiose, cellobiose (PubMed:29273737).
Displays amylase activity (PubMed:29273737).
Displays a depolymerase activity that specifically degrades the polysaccharides of Klebsiella pneumoniae capsule, which allows the phage to reach the host cell membrane and bind the entry receptor (PubMed:28533535).
Hydrolyzes maltose (PubMed:29273737).
Does not hydrolyze alpha-lactose, beta-lactose, trehalose, melibiose, cellobiose (PubMed:29273737).
Displays amylase activity (PubMed:29273737).
pH Dependence
Optimum pH is 5.5-6.0.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | virion component | |
Molecular Function | hydrolase activity, acting on glycosyl bonds | |
Biological Process | adhesion receptor-mediated virion attachment to host cell | |
Biological Process | symbiont entry into host cell via disruption of host cell envelope | |
Biological Process | symbiont entry into host cell via disruption of host cell glycocalyx |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTail tubular protein A
- Short namesTTPA
- Alternative names
Gene names
Organism names
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Uroviricota > Caudoviricetes > Autographiviridae > Studiervirinae > Przondovirus > Przondovirus KP32
- Virus hosts
Accessions
- Primary accessionD1L2W4
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000458730 | 1-192 | Tail tubular protein A | |||
Sequence: MNMQDAYFGSAAELDAVNEMLAAIGESPVTTLDEDGSADVANARRILNRINRQIQSKGWAFNINESATLTPDVSTGLIPFRPAYLSILGGQYVNRGGWVYDKSTGTDTFSGPITVTLITLQDYDEMPECFRQWIVTKASRQFNSRFFGAEDVENSLAQEEMEARMACNEYEMDFGQYNMLDGDAYVQGLIGR |
Interaction
Subunit
Homotetramer.
Family & Domains
Sequence similarities
Belongs to the tail tubular protein gp11 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length192
- Mass (Da)21,375
- Last updated2010-01-19 v1
- ChecksumD6DD559907EB6F7E
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
GQ413937 EMBL· GenBank· DDBJ | ACY66693.1 EMBL· GenBank· DDBJ | Genomic DNA |