D1L2U6 · D1L2U6_BPK32
- ProteinSingle-stranded DNA-binding protein
- Gene13
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids231 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Single-stranded DNA-binding protein that participates in viral DNA replication, formation of concatemers, recombination and repair of double-stranded breaks. Coats the lagging-strand ssDNA as the replication fork advances and stimulates the activities of viral DNA polymerase and primase/helicase. Coordinates simultaneous synthesis of leading- and lagging-strands. Together with DNA primase/helicase, promotes pairing of two homologous DNA molecules containing complementary single-stranded regions and mediates homologous DNA strand exchange. Promotes also the formation of joint molecules. Disrupts loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | single-stranded DNA binding | |
Biological Process | DNA recombination | |
Biological Process | DNA repair | |
Biological Process | viral DNA genome replication |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSingle-stranded DNA-binding protein
- Short namesSSB protein
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Uroviricota > Caudoviricetes > Autographiviridae > Studiervirinae > Przondovirus > Przondovirus KP32
- Virus hosts
Accessions
- Primary accessionD1L2U6
Proteomes
Interaction
Subunit
Homodimer. Interacts (via C-terminus) with the viral DNA polymerase. Interacts with the viral helicase/primase. Part of the replicase complex that includes the DNA polymerase, the primase/helicase and the single-stranded DNA binding protein.
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 13-179 | Single-stranded DNA-binding protein BPT7 | ||||
Sequence: IGTCEPYAYFNKPDYGGEGFENPRGTYKGSVTFKNEDCQELVDLIVKTHEENYAARLEAHEANPPKVQKGKKPLKPYEGDMPFFDNGDGTTTFNFKCYGSYEDKKTGETKKIVLGVVDAKGKRIQDVPIIGGGSKVKIRFSLVPYGWSAVAGASVKLQLEGVMLVEL | ||||||
Region | 186-231 | Disordered | ||||
Sequence: EDDWADEAVEGGYEADEPRSRKPQEDPEDWSGEEADEGEAEEDDDF | ||||||
Compositional bias | 197-213 | Basic and acidic residues | ||||
Sequence: GYEADEPRSRKPQEDPE | ||||||
Compositional bias | 214-231 | Acidic residues | ||||
Sequence: DWSGEEADEGEAEEDDDF |
Domain
The acidic C-terminus is involved in modulating the ssDNA binding properties. It is also required for dimer formation and for interactions with the viral DNA polymerase and the helicase.
Sequence similarities
Belongs to the Teseptimavirus single-stranded DNA-binding protein family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length231
- Mass (Da)25,538
- Last updated2010-01-19 v1
- Checksum6D26A8500AE2DB7F
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 197-213 | Basic and acidic residues | ||||
Sequence: GYEADEPRSRKPQEDPE | ||||||
Compositional bias | 214-231 | Acidic residues | ||||
Sequence: DWSGEEADEGEAEEDDDF |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
GQ413937 EMBL· GenBank· DDBJ | ACY66675.1 EMBL· GenBank· DDBJ | Genomic DNA |