D0NVB5 · AVR1_PHYIT
- ProteinRxLR effector protein Avr1
- GeneAvr1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids208 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Secreted effector that acts as an elicitor of hypersensitive response (HR) specifically on plants carrying defense protein R1, through its interaction with this protein (PubMed:12000683, PubMed:25760731, PubMed:29910515).
Acts also as a virulence factor that promotes colonization and suppresses cell death induced by CRN2 as well as callose deposition, a hallmark of basal defense (PubMed:26336092, PubMed:30329083).
Interacts with host exocyst component Sec5 and thereby disturbs vesicle trafficking, a cellular process that is important for basal defense. By targeting and stabilizing Sec5 in the cytoplasm, the exocyst complex is thus out of balance and not able to mediate the focal secretion of PR-1 and callose (PubMed:26336092).
Acts also as a virulence factor that promotes colonization and suppresses cell death induced by CRN2 as well as callose deposition, a hallmark of basal defense (PubMed:26336092, PubMed:30329083).
Interacts with host exocyst component Sec5 and thereby disturbs vesicle trafficking, a cellular process that is important for basal defense. By targeting and stabilizing Sec5 in the cytoplasm, the exocyst complex is thus out of balance and not able to mediate the focal secretion of PR-1 and callose (PubMed:26336092).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | host cell nucleus | |
Cellular Component | host cell peroxisome |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameRxLR effector protein Avr1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Sar > Stramenopiles > Oomycota > Peronosporales > Peronosporaceae > Phytophthora
Accessions
- Primary accessionD0NVB5
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 70-92 | Does not abolish the recognition of Avr1 by host R1. | ||||
Sequence: Missing | ||||||
Mutagenesis | 111-136 | Abolishes the recognition of Avr1 by host R1. | ||||
Sequence: Missing | ||||||
Mutagenesis | 137-157 | Abolishes the recognition of Avr1 by host R1. | ||||
Sequence: Missing | ||||||
Mutagenesis | 158-170 | Abolishes the recognition of Avr1 by host R1. | ||||
Sequence: Missing | ||||||
Mutagenesis | 170-208 | Loses the virulence function, but also the ability to suppress CRN2-induced cell death and to interact with Sec5. | ||||
Sequence: Missing |
Miscellaneous
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MGLMHRVLLLATFALLCMHAKA | ||||||
Chain | PRO_5003013687 | 23-208 | RxLR effector protein Avr1 | |||
Sequence: AGFDHDKVPRTVERGGGARQLRTATMSDDEARVSKLPSFIESFVKNRKIESWIQNKVTDDFVLSELKLVRLPGTSLADDPNFKLFQKFKIGGWLEEKATTTKAWENLGLDSLPFDQVSKIDEFKTYTQYVTVLNKKASKLDIDQWHGLLSGGSPEELMAKAMILRTLGRDVLERRVMLGGHVVVPF |
Expression
Induction
Expression is induced during host plant infection.
Interaction
Structure
Family & Domains
Features
Showing features for motif, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 41-54 | RxLR-dEER | ||||
Sequence: RQLRTATMSDDEAR | ||||||
Region | 70-92 | W1-motif | ||||
Sequence: KIESWIQNKVTDDFVLSELKLVR | ||||||
Region | 93-110 | Linker region ln1 | ||||
Sequence: LPGTSLADDPNFKLFQKF | ||||||
Region | 111-136 | W2-motif | ||||
Sequence: KIGGWLEEKATTTKAWENLGLDSLPF | ||||||
Region | 137-157 | Y-motif | ||||
Sequence: DQVSKIDEFKTYTQYVTVLNK | ||||||
Region | 158-170 | Linker region ln2 | ||||
Sequence: KASKLDIDQWHGL | ||||||
Region | 170-208 | T-region | ||||
Sequence: LLSGGSPEELMAKAMILRTLGRDVLERRVMLGGHVVVPF |
Domain
The RxLR-dEER motif acts to carry the protein into the host cell cytoplasm through binding to cell surface phosphatidylinositol-3-phosphate.
The C-terminal domain of Avr1 comprises three motifs (W1, W2, and Y), two linker regions (ln1 and ln2), and at the very end the T-region. The T-region of AVR1 is important but not sufficient to trigger R1-mediated HR and W1, W2 and Y are equally important for recognition by R1.
Sequence similarities
Belongs to the RxLR effector family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length208
- Mass (Da)23,420
- Last updated2009-12-15 v1
- Checksum995A5BEC2D3E718C
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DS028168 EMBL· GenBank· DDBJ | EEY66592.1 EMBL· GenBank· DDBJ | Genomic DNA |