D0N0Z8 · RD24_PHYIT
- ProteinRxLR effector protein PexRD24
- GenePexRD24
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids154 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Effector that interacts with isoforms of host protein phosphatase type 1c (PP1c), mimicking a regulatory subunit and causing their re-localization within the host nucleus (PubMed:26822079).
The holoenzymes formed with PP1c isoforms act to promote late blight by attenuating jasmonic acid (JA)- and salicylic acid (SA)-mediated transcriptional responses of the host plant (PubMed:26822079).
The holoenzymes formed with PP1c isoforms act to promote late blight by attenuating jasmonic acid (JA)- and salicylic acid (SA)-mediated transcriptional responses of the host plant (PubMed:26822079).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | host cell nucleolus | |
Cellular Component | host cell nucleoplasm |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameRxLR effector protein PexRD24
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Sar > Stramenopiles > Oomycota > Peronosporales > Peronosporaceae > Phytophthora
Accessions
- Primary accessionD0N0Z8
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 138-141 | Abolishes the interaction with PP1c-1, PP1c-2 and PP1c-3, and attenuates infection. | ||||
Sequence: KVTF → AAAA |
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MHSSLLWLGAVVALLAVNNVTA | ||||||
Chain | PRO_5003012822 | 23-154 | RxLR effector protein PexRD24 | |||
Sequence: VSTEANGQVALSTSKGQLAGERAEEENSIVRSLRAVETSEDEEERDLLGLFAKSKLKKMMKSESFKLKRFGEWDDFTVGYIREKLKNKYPDLLLNYLNVYKKAGNEIVRHANNPNKVTFSNKVRARIYKTNS |
Expression
Induction
Expression is up-regulated during the biotrophic phase of infection on potato plants.
Interaction
Subunit
Interacts with the potato PP1c family proteins PP1c-1, PP1c-2 and PP1c-3.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 53-67 | RxLR-dEER | ||||
Sequence: RSLRAVETSEDEEER | ||||||
Motif | 138 | PP1c-binding motif | ||||
Sequence: K |
Domain
The RxLR-dEER motif acts to carry the protein into the host cell cytoplasm through binding to cell surface phosphatidylinositol-3-phosphate.
The KVTF motif (residues 138 to 141) is required for the interaction with the PP1c family proteins PP1c-1, PP1c-2 and PP1c-3.
Sequence similarities
Belongs to the RxLR effector family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length154
- Mass (Da)17,382
- Last updated2009-12-15 v1
- Checksum20568799F5B50405
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DS028122 EMBL· GenBank· DDBJ | EEY67311.1 EMBL· GenBank· DDBJ | Genomic DNA |