D0EXD3 · AFP_PENCH
- ProteinAntifungal protein B
- GenepafB
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Antifungal protein that acts as an inhibitor of growth of human pathogenic molds and yeasts (PubMed:19683356, PubMed:29379111).
Is active against the model organism Neurospora crassa, the opportunistic human pathogens Aspergillus fumigatus, Trichophyton rubrum, and Aspergillus terreus (PubMed:29379111).
Provokes a reduction of the incidence of infections caused by Penicillium digitatum and Penicillium italicum in oranges and by Penicillium expansum in apples (PubMed:34199956).
Low doses of pafB have self-inhibition activity (PubMed:29379111).
Shows also activity against the model yeast Saccaromyces cerevisiae and the opportunistic human pathogen Candida albicans (PubMed:29379111, PubMed:35499318).
No antibacterial activity is observed on the Gram-negative Escherichia coli and the Gram-positive Bacillus subtilis (PubMed:29379111).
Finally, shows also anti-viral activity in a model of HCoV 229E infected L132 cells (PubMed:29379111).
Is active against the model organism Neurospora crassa, the opportunistic human pathogens Aspergillus fumigatus, Trichophyton rubrum, and Aspergillus terreus (PubMed:29379111).
Provokes a reduction of the incidence of infections caused by Penicillium digitatum and Penicillium italicum in oranges and by Penicillium expansum in apples (PubMed:34199956).
Low doses of pafB have self-inhibition activity (PubMed:29379111).
Shows also activity against the model yeast Saccaromyces cerevisiae and the opportunistic human pathogen Candida albicans (PubMed:29379111, PubMed:35499318).
No antibacterial activity is observed on the Gram-negative Escherichia coli and the Gram-positive Bacillus subtilis (PubMed:29379111).
Finally, shows also anti-viral activity in a model of HCoV 229E infected L132 cells (PubMed:29379111).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | host cell cytoplasm | |
Biological Process | defense response to fungus | |
Biological Process | killing of cells of another organism |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameAntifungal protein B
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Eurotiomycetes > Eurotiomycetidae > Eurotiales > Aspergillaceae > Penicillium > Penicillium chrysogenum species complex
Accessions
- Primary accessionD0EXD3
Subcellular Location
PTM/Processing
Features
Showing features for signal, propeptide, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-18 | |||||
Sequence: MQITSIAIVFFAAMGAVA | ||||||
Propeptide | PRO_0000391701 | 19-34 | ||||
Sequence: NPIARESDDLDARDVQ | ||||||
Chain | PRO_0000391702 | 35-92 | Antifungal protein B | |||
Sequence: LSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKKCKSDRHHCEYDEHHKRVDCQTPV | ||||||
Disulfide bond | 42↔70 | |||||
Sequence: CSLKHNTCTYLKGGKNHVVNCGSAANKKC | ||||||
Disulfide bond | 49↔77 | |||||
Sequence: CTYLKGGKNHVVNCGSAANKKCKSDRHHC | ||||||
Disulfide bond | 62↔88 | |||||
Sequence: CGSAANKKCKSDRHHCEYDEHHKRVDC |
Keywords
- PTM
Expression
Induction
Expression is strongly induced under nutrient excess during the logarithmic growth phase, whereas it remains under the detection level in the supernatant of cultures grown under nutrient limitation.
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length92
- Mass (Da)10,119
- Last updated2009-11-24 v1
- Checksum8F7DF4D5B4473E5A
Mass Spectrometry
Keywords
- Technical term